Align CBP protein aka CebG, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate WP_086510783.1 BZY95_RS15420 carbohydrate ABC transporter permease
Query= TCDB::Q9X9R5 (276 letters) >NCBI__GCF_002151265.1:WP_086510783.1 Length = 292 Score = 118 bits (295), Expect = 2e-31 Identities = 92/278 (33%), Positives = 136/278 (48%), Gaps = 20/278 (7%) Query: 14 YVVLTVFALVSLAPLVWTAIAASRTNHRLAETPPPLWFGGNLFKNLEA---AWEQA---- 66 Y VL + AL L PL I + + LAE P L AW +A Sbjct: 20 YAVLLLAALFYLLPLAVMLITSVKP---LAEITPGTLLSLPREPTLAPWGKAWGEACTGM 76 Query: 67 ---GLGTAMLNSV-IVAGTITVSTVLFSTLAGFAFAKLRFRFSGLLLLLTIGTMMIPPQL 122 G+G NS+ IV + +ST + L G+A K RF+ S LL L + IP Q+ Sbjct: 77 RCEGIGVYFFNSIAIVVPAVLISTAI-GALNGYALTKWRFKGSELLFALMLFGCFIPFQV 135 Query: 123 AVVPLYLWMSDLGWSNQLHTVILPSLV--TAFGTFFMRQYLVQALPTELIEAARVDGASS 180 ++P+ + LG S+ +IL ++ AF T F R + V A+PTEL+ AA++DGA Sbjct: 136 VLLPMAQTLGWLGLSSSRAGLILVHVIFGIAFTTLFFRNFYV-AVPTELVSAAKLDGAGF 194 Query: 181 LRIVWHVVFPAARPAMAVLGLLTFVFAWNDFLWPII--ALNQQNPTVQVGPELARHRVLP 238 RI W ++ P + P + V + F WNDFL+ + A N Q TV + + Sbjct: 195 FRIFWRILLPVSAPIIVVSVIWQFTQIWNDFLFGVAFSAHNTQPVTVALNNLVNTSTGAR 254 Query: 239 DQAVIMAGALLGTLPLLVAFLLFGKQIVGGIMQGAIKG 276 + V MA A++ LP L+ ++L GK V G+ G++KG Sbjct: 255 EYNVDMAAAMIAALPTLIVYVLAGKYFVRGLTAGSVKG 292 Lambda K H 0.327 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 292 Length adjustment: 26 Effective length of query: 250 Effective length of database: 266 Effective search space: 66500 Effective search space used: 66500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory