Align Putative aldehyde dehydrogenase transmembrane protein; EC 1.2.1.3 (characterized, see rationale)
to candidate WP_086510804.1 BZY95_RS15485 NAD-dependent succinate-semialdehyde dehydrogenase
Query= uniprot:Q92L07 (510 letters) >NCBI__GCF_002151265.1:WP_086510804.1 Length = 481 Score = 222 bits (565), Expect = 3e-62 Identities = 153/444 (34%), Positives = 228/444 (51%), Gaps = 15/444 (3%) Query: 37 SPVTGEKIASLKTVSAAEAAGKIEKADEAFRAWRLVPAPKRGELVRLLGEELRAFKADLG 96 +P GE +AS+ +SA +A + A+ A+ AWR A +R L+R + + A + L Sbjct: 29 NPANGETLASVPDLSADDARDAVAAAEAAWPAWRRQTAKQRAALLRAWFDAIMAHQESLA 88 Query: 97 RLVSIEAGKIPSEGLGEVQEMIDICDFAVGLSRQLYGLTIATERPGHRMMETWHPLGVVG 156 R++++E GK +E GEV +F ++++ G T+ + R++ P+GVV Sbjct: 89 RMMTLEQGKPLAESRGEVAYGASFVEFYAEQAKRMAGETLPSHGADKRILVFREPVGVVA 148 Query: 157 IISAFNFPVAVWSWNAALALVCGDAVVWKPSEKTPLTALACQAILERAIARFGDAPEGLS 216 I+ +NFP+A+ + A AL G VV KP+E TPLTALA + E+ P G+ Sbjct: 149 AITPWNFPLAMITRKCAPALAAGCPVVIKPAEATPLTALALARLAEQV-----GFPAGVL 203 Query: 217 QVLIGDR--AIGEVLVDHPKVPLVSATGSTRMGREVGPRLAKRFARAILELGGNNAGIVC 274 V+ R IGEVL P+V VS TGST +G+ + + A +A +ELGGN IV Sbjct: 204 NVVTASRPAEIGEVLTSDPRVRKVSFTGSTAVGKRLLAQCAGTVKKASMELGGNAPFIVF 263 Query: 275 PSADLDMALRAIAFGAMGTAGQRCTTLRRLFVHESVYDQLVPRLKKAYQSVSVGNPLESA 334 ADLD A+ +GQ C RL V VY+ V +L + VGN L+ Sbjct: 264 DDADLDAAVEGAVASKYRNSGQTCVCTNRLLVQSGVYEAFVEKLAARVAQLKVGNGLDEG 323 Query: 335 ALVGPLVDKAAFDGMQKAIAEAKNHGG-AVTGGERVELGHENGYYVKPALVEMPKQEGPV 393 + GPL+++AA D +Q IA+A G V GGE LG G + +P +V E V Sbjct: 324 VVQGPLINQAAVDKVQSHIADALAKGARLVCGGEPHALG---GTFFQPTVVADVTDEMRV 380 Query: 394 L-EETFAPILYVMKYSDFDAVLAEHNAVAAGLSSSIFTRDMQESERFLAADGSDCGIANV 452 EETF P+ V ++ + +A NA GL++ + RD + + +G + G+ V Sbjct: 381 AREETFGPLAPVFRFDSDEQAIAMANATEFGLAAYFYARDYRRIWHVM--EGLEYGMVAV 438 Query: 453 NIGTSGAEIGGAFGGEKETGGGRE 476 N G E+ FGG KE+G GRE Sbjct: 439 NEGILSTEL-APFGGVKESGLGRE 461 Lambda K H 0.317 0.134 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 557 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 510 Length of database: 481 Length adjustment: 34 Effective length of query: 476 Effective length of database: 447 Effective search space: 212772 Effective search space used: 212772 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory