Align Probable aspartate aminotransferase; AspAT; EC 2.6.1.1; Transaminase A (uncharacterized)
to candidate WP_086510842.1 BZY95_RS15720 pyridoxal phosphate-dependent aminotransferase
Query= curated2:P63499 (429 letters) >NCBI__GCF_002151265.1:WP_086510842.1 Length = 410 Score = 520 bits (1340), Expect = e-152 Identities = 246/406 (60%), Positives = 319/406 (78%), Gaps = 4/406 (0%) Query: 27 AFAQSAKLQDVLYEIRGPVHQHAARLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQAL 86 +F +S KL +V Y+IRGPV +HA RLE EGHRILKLNIGNPAPFGFEAP+ I++D+++ L Sbjct: 6 SFRKSHKLDNVCYDIRGPVLEHAKRLEDEGHRILKLNIGNPAPFGFEAPEEILQDVMRNL 65 Query: 87 PYAQGYSDSQGILSARRAVVTRYELVPGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQ 146 P AQGY DS+G+ SAR+A++ + P ++D+++GNGVSELI M LQALL++GD+ Sbjct: 66 PTAQGYCDSKGLYSARKAIMQECQRKE-IPGVGIEDIFIGNGVSELIVMALQALLNDGDE 124 Query: 147 VLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQPDIADLESKITERTKALVVINPNNPT 206 VLIP+PDYPLWTA+ L+GG VHY CDE W PDIAD+ +K+T T+A+V+INPNNPT Sbjct: 125 VLIPAPDYPLWTAAAHLSGGHAVHYRCDEQADWAPDIADVRAKVTSHTRAIVIINPNNPT 184 Query: 207 GAVYSCEILTQMVDLARKHQLLLLADEIYDKILYDDAKHISLASIAP-DMLCLTFNGLSK 265 GAVY E++ +++ +AR+H L++ +DEIYDKILYD +H+S ++A D L +T NGLSK Sbjct: 185 GAVYPPEVVRELLAIAREHDLVVFSDEIYDKILYDGTEHVSTGALADEDQLVVTLNGLSK 244 Query: 266 AYRVAGYRAGWLAITGP--KEHASSFIEGIGLLANMRLCPNVPAQHAIQVALGGHQSIED 323 +YR AG+R+GW+ ++G + A +I+G+ +LA+MRLC NVPAQHAIQ ALGG+QSI D Sbjct: 245 SYRCAGFRSGWMILSGSVAMQRAQDYIQGLNMLASMRLCANVPAQHAIQTALGGYQSIND 304 Query: 324 LVLPGGRLLEQRDIAWTKLNEIPGVSCVKPAGALYAFPRLDPEVYDIDDDEQLVLDLLLS 383 L+LPGGRLL QRDI + KLN IPGVSC K GALYAFPRLDP+VY I DD++LVLDLLL Sbjct: 305 LILPGGRLLAQRDITYEKLNAIPGVSCTKAKGALYAFPRLDPKVYPIQDDQKLVLDLLLQ 364 Query: 384 EKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERLGNFLVSYRQ 429 EKIL+ QGT FNWP PDH+R+VTLPW+ L A++R FL YRQ Sbjct: 365 EKILLVQGTAFNWPEPDHVRIVTLPWADQLGDALDRFARFLARYRQ 410 Lambda K H 0.320 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 620 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 410 Length adjustment: 32 Effective length of query: 397 Effective length of database: 378 Effective search space: 150066 Effective search space used: 150066 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory