Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate WP_086510990.1 BZY95_RS16560 L-arabinose ABC transporter permease AraH
Query= TCDB::G4FGN4 (313 letters) >NCBI__GCF_002151265.1:WP_086510990.1 Length = 336 Score = 181 bits (458), Expect = 3e-50 Identities = 105/304 (34%), Positives = 169/304 (55%), Gaps = 3/304 (0%) Query: 11 AGIFLILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLSVGSI 70 +G+ I + + V L V FLT N+ ++L+++ I ++ M MV+ +DLSV SI Sbjct: 33 SGLIAIFVILFVALAVFIPGFLTGRNMVGLLLSITLIGTIATTMMMVLALGEVDLSVASI 92 Query: 71 LGAASVVMGLLMDEKGLSPFLSVVIGLAVGVGFGLANGLLITKARLAPFISTLGMLSVGR 130 + A VV ++ G S + V+ G+ G G NG ++ K + I+TL + R Sbjct: 93 VAFAGVVAAVVTSTSG-SVAIGVLGGVLAGGAVGAFNGFVVAKFGINSLIATLASMEFVR 151 Query: 131 GLAYVMSGGWPIS-PFPESFTVHGQGMVGPVPVPVIYMAVIGVIAHIFLKYTVTGRRIYA 189 GLAY+ S G + PE F + +G + +PV M VI + L T GR + A Sbjct: 152 GLAYITSRGDAVMITVPEFFDLGSASFLG-LTLPVWTMIACFVIFGVLLNMTAFGRNVLA 210 Query: 190 IGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGVAQPNAGQGYELDVIAAT 249 GGN EA+ L G+ R+ ++V+ + G +A AG LL + +G+ PN G EL VI+A Sbjct: 211 TGGNAEAAALAGVNVRRLKVIVFGLQGVVAGIAGVLLASRMGLGDPNTSMGLELAVISAC 270 Query: 250 VIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIIIAIAIDQIRR 309 V+GG +LSGG TI G +G +IMG ++N M LL V +F+Q +V G ++++A+ D+ ++ Sbjct: 271 VLGGVALSGGVATITGVLVGVLIMGCVQNAMGLLNVPTFYQYLVRGAILLLAVMFDRWKQ 330 Query: 310 AKER 313 + + Sbjct: 331 TRRQ 334 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 336 Length adjustment: 28 Effective length of query: 285 Effective length of database: 308 Effective search space: 87780 Effective search space used: 87780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory