Align L-arabinonolactonase (characterized, see rationale)
to candidate WP_086510992.1 BZY95_RS16570 SMP-30/gluconolactonase/LRE family protein
Query= uniprot:A0A1I2AUG6 (300 letters) >NCBI__GCF_002151265.1:WP_086510992.1 Length = 304 Score = 152 bits (384), Expect = 9e-42 Identities = 110/289 (38%), Positives = 148/289 (51%), Gaps = 23/289 (7%) Query: 13 LGEGILWCEREQA---LYWTDIQAATLWRHRPADGATRSWEMPERLGCLALCEADG-WLL 68 LG G LWC + L + DI L+ H A G TR W + E C + ADG + Sbjct: 25 LGGGPLWCPGQGEAGRLLFVDILRRALYVHDFASGTTRGWPLEEAC-CWLVPRADGDGFI 83 Query: 69 LGLATRLAFFRPEDD---LLLPLVSVEPDLPTRLNDGACDRQGRFVFGTL--HEPAAGET 123 GLA+RL R E+ ++ V+ E R N+ A D GR FG++ +E +GE Sbjct: 84 AGLASRLVHLRLEEHGPRIVDDWVTPEEPAGNRFNNAAVDTLGRLWFGSMSENEQESGEP 143 Query: 124 RQPIGAFYRLNADLTLERLNLPGIGISNSVAFSPDGRTMYFCDSPSRVIQCCDY---GDR 180 Q GA YRL+ L R++ G G++N A SPDGRT+Y D+ + ++ + G+ Sbjct: 144 GQ--GALYRLDG-AGLRRVD-HGYGVANGPAVSPDGRTLYHSDTAAGIVYAYELAADGEL 199 Query: 181 CGEPRVFARVDDERGEPDGSAVDAQGCLWNAQWGLGRVVRYAPDGRVDRIVEVPATQPTR 240 G R R +G PDG D +G LW A WG GRV R+ PDG +D + +PA++ T Sbjct: 200 TGR-REHLRFHGAQGYPDGMTCDVEGGLWVAHWGGGRVSRFLPDGTLDETLLLPASRVTS 258 Query: 241 PAFGDSPLDTLYITSARDGLSSAALATQPLAGALFAADAGASGLPEPRF 289 AFG LD LYIT+A DG A LAG+LF G GL P F Sbjct: 259 CAFGGPELDQLYITTAADGRDQEA-----LAGSLFRVAPGVRGLASPMF 302 Lambda K H 0.321 0.139 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 304 Length adjustment: 27 Effective length of query: 273 Effective length of database: 277 Effective search space: 75621 Effective search space used: 75621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory