Align Gluconolactonase; EC 3.1.1.-; EC 3.1.1.17 (characterized, see rationale)
to candidate WP_086510992.1 BZY95_RS16570 SMP-30/gluconolactonase/LRE family protein
Query= uniprot:Q88NN7 (293 letters) >NCBI__GCF_002151265.1:WP_086510992.1 Length = 304 Score = 143 bits (361), Expect = 4e-39 Identities = 100/288 (34%), Positives = 142/288 (49%), Gaps = 21/288 (7%) Query: 14 GESPVWHPGEQA---LYWVDIPARQLHRWQAADGKHQCWQGDEMLACIA--RSGQGWVAG 68 G P+W PG+ L +VDI R L+ A G + W +E + G G++AG Sbjct: 26 GGGPLWCPGQGEAGRLLFVDILRRALYVHDFASGTTRGWPLEEACCWLVPRADGDGFIAG 85 Query: 69 MESGIFQLQAKADGSLDSRLLSN--VQHAQAGMRFNDGRCDRQGRFWAGTMLLDMQQGAH 126 + S + L+ + G R++ + AG RFN+ D GR W G+M + Q+ Sbjct: 86 LASRLVHLRLEEHGP---RIVDDWVTPEEPAGNRFNNAAVDTLGRLWFGSMSENEQESGE 142 Query: 127 VG--ALYRHDGEGHLHLQQDGMIVPNGLAFSPDGKRMYLSDSHPNVQKVWAFDYDTDSGT 184 G ALYR DG G L G V NG A SPDG+ +Y SD+ + V+A++ D G Sbjct: 143 PGQGALYRLDGAG-LRRVDHGYGVANGPAVSPDGRTLYHSDTAAGI--VYAYELAAD-GE 198 Query: 185 PHGKHLFVDMRNYPGRPDGAAIDQDGCYWICGNDAGQIHRFTPEGRLDRSLSVPVKKPAM 244 G+ + G PDG D +G W+ G++ RF P+G LD +L +P + Sbjct: 199 LTGRREHLRFHGAQGYPDGMTCDVEGGLWVAHWGGGRVSRFLPDGTLDETLLLPASRVTS 258 Query: 245 CAFGGASLDILYVTSIRPTGIDLSDQ-PLAGGVFALDPGTKGLEEPAY 291 CAFGG LD LY+T T D DQ LAG +F + PG +GL P + Sbjct: 259 CAFGGPELDQLYIT----TAADGRDQEALAGSLFRVAPGVRGLASPMF 302 Lambda K H 0.320 0.139 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 36 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 304 Length adjustment: 27 Effective length of query: 266 Effective length of database: 277 Effective search space: 73682 Effective search space used: 73682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory