Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_086511007.1 BZY95_RS16600 SDR family oxidoreductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >NCBI__GCF_002151265.1:WP_086511007.1 Length = 256 Score = 251 bits (642), Expect = 8e-72 Identities = 137/251 (54%), Positives = 165/251 (65%), Gaps = 2/251 (0%) Query: 10 AAVYPSLKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSAD-GHK 68 AA YPSL+ + V +TGGGSGIGA + F RQGA V F DI A SQ LVERL A+ G Sbjct: 5 AARYPSLEQRVVFITGGGSGIGAELTRAFHRQGARVAFVDIDDAASQALVERLKAETGRA 64 Query: 69 ACFERVDLTDVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLK 128 + D+ DVA+LQA IA + + G LVNNAANDDRH E+ AYWDER+S+NL+ Sbjct: 65 PHYRHCDIRDVAALQAAIAEVGREFGPIHTLVNNAANDDRHTWQEVDVAYWDERMSLNLR 124 Query: 129 HIFFCAQAVVPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRD 188 +FF AQA M GGGAI+N GSIS + + +L Y T KAA+ GLTRSLARDLGR Sbjct: 125 PMFFAAQAAAHQMIEAGGGAIINFGSISVQMAIPELSAYVTAKAAVHGLTRSLARDLGRY 184 Query: 189 GIRATCVIPGNVRTPRQL-KWYSPEGEAEIVAAQCLDGRLAPEDVAAMVLFLASDDARLV 247 GIR ++PG++ T RQL KW PE EA I+A QCL RL P +A VLFLAS D+ + Sbjct: 185 GIRVNTLVPGSILTERQLQKWIGPEEEASILAHQCLKLRLEPRHIAPTVLFLASADSAAI 244 Query: 248 TGHSYFVDAGW 258 TG VD GW Sbjct: 245 TGQEIAVDGGW 255 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 256 Length adjustment: 24 Effective length of query: 235 Effective length of database: 232 Effective search space: 54520 Effective search space used: 54520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory