Align N-Acetyl-D-glucosamine ABC transport system, permease component 2 (characterized)
to candidate WP_086511010.1 BZY95_RS16615 carbohydrate ABC transporter permease
Query= reanno::Phaeo:GFF2752 (280 letters) >NCBI__GCF_002151265.1:WP_086511010.1 Length = 275 Score = 158 bits (400), Expect = 1e-43 Identities = 85/274 (31%), Positives = 143/274 (52%), Gaps = 2/274 (0%) Query: 7 SNPFNSILAHGALITYTLIALFPVFVILVNSFKTRKAIFRDPLGLPTSDTFSLVGYQTVL 66 S F + L LI + + P+ FKT + +PL LP D ++ Y + Sbjct: 3 SATFRNTLRVIVLILVASLVIGPLLASFFGGFKTNAELRTNPLWLP--DAWNPQNYVAIF 60 Query: 67 KQGDFFLYFQNSMIVTVVSLALVLLFGAMAAFALAEYRFKGNMLLGLYLALGIMIPIRIG 126 G+F+ Y NS ++ +++ L L+ GA AA+ ++ RF G+ ++ YL LG+M P Sbjct: 61 LDGNFWRYMGNSFFISSMTVLLTLVVGAAAAYVFSQIRFFGSRMIHSYLLLGLMFPFAAA 120 Query: 127 TVAILELMVDTGLVNTLTALILVYTAQGLPLAVFILSEFMKQVSDDLKNAGRIDGLSEYT 186 + + + D GL++T A+IL TA GL LA+ + F Q+ +L A +DG S Sbjct: 121 ILPLFIKVRDLGLLDTYWAVILPQTAFGLSLAILLFKAFFDQLPKELFEAAYVDGCSYLR 180 Query: 187 IFFRLVLPLVRPAMATVAVFNMIPIWNDLWFPLILAPAEETKTLTLGSQVFIGQFVTDWN 246 F+ LPL P +ATV VF + WN+ PL++ T LG F G+++T WN Sbjct: 181 FFWSFTLPLSTPILATVGVFVFVQSWNNFLLPLVVLNDRSIYTWPLGMMQFQGEYLTQWN 240 Query: 247 AVLSALSMAILPVMVLYVIFSRQLIRGITSGAVK 280 +L+ +++ I P ++ ++ + ++ G+T G+VK Sbjct: 241 MILAFVTLTITPAVIFFLAAQKYIVAGLTGGSVK 274 Lambda K H 0.330 0.143 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 275 Length adjustment: 25 Effective length of query: 255 Effective length of database: 250 Effective search space: 63750 Effective search space used: 63750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory