Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_086511012.1 BZY95_RS16625 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::P54933 (332 letters) >NCBI__GCF_002151265.1:WP_086511012.1 Length = 346 Score = 407 bits (1045), Expect = e-118 Identities = 207/333 (62%), Positives = 253/333 (75%), Gaps = 1/333 (0%) Query: 1 MGKITLRNVQKRF-GEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQ 59 M +TL +++K F G+ VIP+L+L IEDG F V VGPSGCGKSTLLR+IAGLE V+ G Sbjct: 1 MADVTLVDIEKTFRGKTTVIPNLNLRIEDGSFTVLVGPSGCGKSTLLRMIAGLETVTRGA 60 Query: 60 IMIDGRDATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAK 119 I I GRD T P++R +AMVFQSYALYPHMTV +NI F +R+AK+ +E +V+ AA+ Sbjct: 61 ISIGGRDVTTAEPSERNIAMVFQSYALYPHMTVARNIDFGMRLAKVPTEERMAKVAEAAR 120 Query: 120 ILNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITEL 179 +LNL L+R+P +LSGGQRQRVAIGRAIVR P FLFDEPLSNLDAALR MR+E+ EL Sbjct: 121 LLNLEELLERKPAELSGGQRQRVAIGRAIVRNPGVFLFDEPLSNLDAALRNRMRVELAEL 180 Query: 180 HQSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIGSPKM 239 HQ L+ TMIYVTHDQVEAMT+AD IVV+NAG+IEQVG+P+ LY+ P LFVAGFIGSPKM Sbjct: 181 HQRLDATMIYVTHDQVEAMTLADCIVVMNAGQIEQVGTPMNLYQRPETLFVAGFIGSPKM 240 Query: 240 NLIEGPEAAKHGATTIGIRPEHIDLSREAGAWEGEVGVSEHLGSDTFLHVHVAGMPTLTV 299 NLIEG A HGATT+GIRPEH+++S EAG W V V E LG+D F +V LTV Sbjct: 241 NLIEGEVAKAHGATTLGIRPEHLEVSHEAGEWRTRVRVVEMLGADAFAYVDSDATGPLTV 300 Query: 300 RTGGEFGVHHGDRVWLTPQADKIHRFGADGKAL 332 R G+ V GD ++LTP+ + +H FG DG+ L Sbjct: 301 RLPGDAEVRSGDILYLTPRYELLHAFGIDGRRL 333 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 346 Length adjustment: 28 Effective length of query: 304 Effective length of database: 318 Effective search space: 96672 Effective search space used: 96672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory