Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate WP_086511037.1 BZY95_RS16760 aldo/keto reductase
Query= SwissProt::O32210 (276 letters) >NCBI__GCF_002151265.1:WP_086511037.1 Length = 296 Score = 125 bits (314), Expect = 1e-33 Identities = 85/266 (31%), Positives = 141/266 (53%), Gaps = 23/266 (8%) Query: 15 VEMPWFGLGVFKVENG----NEATESVKAAIKNGYRSIDTAAIYKN---EEGVGIGIKES 67 +E+P G G + + G ++ +++ ++ G IDTA +Y + EE VG + Sbjct: 20 LELPAIGQGTWYMGEGLAPRSDEVRALQQGLELGLTLIDTAEMYADGGAEEVVGEALAGR 79 Query: 68 GVAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALE 127 R++ F+ SKV+ + G ++ + A E+SL RL D+LDLYL+HWPG +T A E Sbjct: 80 ---RDQAFLVSKVYPWNAGRDSAIDACERSLRRLGTDHLDLYLLHWPGSIPLAETLEAFE 136 Query: 128 KLYKDGKIRAIGVSNFQVHHLEELLK-DAEIKPMVNQVEFH--PRLTQKELRDYCKGQGI 184 +L + GKIR GVSNF V L+ L+ + VNQV +H R + LR + G+ Sbjct: 137 RLREQGKIRRFGVSNFDVEELDSLVALPGGGECAVNQVLYHLGSRGIEHALRPRMQRLGM 196 Query: 185 QLEAWSPLMQG-----QLLDNEVLTQIAEKHNKSVAQVILRWDL-----QHGVVTIPKSI 234 L A+ PL Q L ++ + ++A+ + AQ++L W + + V+ IPK++ Sbjct: 197 PLMAYCPLAQAGQLRRDLFEHSAVREVADGLGITPAQLLLAWAIRPLNGRRDVIAIPKAV 256 Query: 235 KEHRIIENADIFDFELSQEDMDKIDA 260 + + EN + ELS E + ++DA Sbjct: 257 QPQHVAENTAALEVELSDEALARLDA 282 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 296 Length adjustment: 26 Effective length of query: 250 Effective length of database: 270 Effective search space: 67500 Effective search space used: 67500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory