Align MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_086511158.1 BZY95_RS17250 carbohydrate ABC transporter permease
Query= TCDB::O30493 (276 letters) >NCBI__GCF_002151265.1:WP_086511158.1 Length = 272 Score = 380 bits (977), Expect = e-110 Identities = 185/271 (68%), Positives = 229/271 (84%), Gaps = 1/271 (0%) Query: 6 SRRLQSLLLGTLAWAIAILIFFPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYLHINER 65 S ++ + L L W IA++IFFPI WMVLT FKTE +A A P IFTPTLE+Y+ + R Sbjct: 3 SAGMRRVWLTLLGWGIALIIFFPILWMVLTGFKTEAEAIADP-SLIFTPTLESYVAVQAR 61 Query: 66 SNYFSYAWNSVLISFSATALCLLISVPAAYSMAFYETKRTKSTLLWMLSTKMLPPVGVLM 125 ++YF +A NSV+++F +T L LLI++PAAY+MAF T+RTK+TLLWMLSTKMLPPVGVL+ Sbjct: 62 ADYFKFASNSVVVAFGSTLLALLIAIPAAYAMAFLPTRRTKATLLWMLSTKMLPPVGVLV 121 Query: 126 PIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGATLWQEM 185 PIYL+ + GLLDTR LII+YTL+NLPIVVWM+YT+FKD+P+DILEA R+DGA+ +QE+ Sbjct: 122 PIYLIFRDLGLLDTRSGLIIVYTLMNLPIVVWMLYTFFKDLPRDILEAGRMDGASTFQEV 181 Query: 186 VRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLTSSNAAPLTALIASYSSPEGLFWAKLS 245 V +LLP+ G+AST LLS+IL WNEAFWSLNLTSSNAAPLTA IAS+SSPEGLFWAKLS Sbjct: 182 VYLLLPLTLPGIASTGLLSVILSWNEAFWSLNLTSSNAAPLTAYIASFSSPEGLFWAKLS 241 Query: 246 AVSTLACAPILIFGWISQKQLVRGLSFGAVK 276 A ST+A APILIFGW++QKQ+VRGL+FGAVK Sbjct: 242 AASTMAIAPILIFGWLTQKQMVRGLTFGAVK 272 Lambda K H 0.327 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 272 Length adjustment: 25 Effective length of query: 251 Effective length of database: 247 Effective search space: 61997 Effective search space used: 61997 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory