Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_086511158.1 BZY95_RS17250 carbohydrate ABC transporter permease
Query= uniprot:D8IPH9 (270 letters) >NCBI__GCF_002151265.1:WP_086511158.1 Length = 272 Score = 141 bits (356), Expect = 1e-38 Identities = 80/245 (32%), Positives = 129/245 (52%), Gaps = 6/245 (2%) Query: 11 WGVGIVLVLVAVFPLLWALLNSVKTLLDIVTPTPRFLFTPTLENYRQVIGSPEVLVGLTN 70 WG+ +++ FP+LW +L KT + + P +FTPTLE+Y V + +N Sbjct: 16 WGIALIIF----FPILWMVLTGFKTEAEAIAD-PSLIFTPTLESYVAVQARADYFKFASN 70 Query: 71 SAVIVGSAVLLGTFMGVPAAYVIARYHVPGKRDIQFFLLSLRFLPPVAVAIPLIAIWVDL 130 S V+ + LL + +PAAY +A + ++LS + LPPV V +P+ I+ DL Sbjct: 71 SVVVAFGSTLLALLIAIPAAYAMAFLPTRRTKATLLWMLSTKMLPPVGVLVPIYLIFRDL 130 Query: 131 GLYDTRFSMIVTYLLTTLSTITWLSIPVFQRMPREIEEAATLDGYGPYAVFWKIALPNCA 190 GL DTR +I+ Y L L + W+ F+ +PR+I EA +DG + + LP Sbjct: 131 GLLDTRSGLIIVYTLMNLPIVVWMLYTFFKDLPRDILEAGRMDGASTFQEVVYLLLPLTL 190 Query: 191 TTLLGGIIFSFVLVWNELMIALALTSSNSATLPVVASAFTSMGQEVPWGVINASTVLLAL 250 + + S +L WNE +L LTSSN+A L ++F+S + + W ++A++ + Sbjct: 191 PGIASTGLLSVILSWNEAFWSLNLTSSNAAPLTAYIASFSS-PEGLFWAKLSAASTMAIA 249 Query: 251 PPLIF 255 P LIF Sbjct: 250 PILIF 254 Lambda K H 0.327 0.142 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 272 Length adjustment: 25 Effective length of query: 245 Effective length of database: 247 Effective search space: 60515 Effective search space used: 60515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory