Align ABC transporter for D-mannitol and D-mannose, permease component 2 (characterized)
to candidate WP_086511158.1 BZY95_RS17250 carbohydrate ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_25890 (276 letters) >NCBI__GCF_002151265.1:WP_086511158.1 Length = 272 Score = 380 bits (977), Expect = e-110 Identities = 187/268 (69%), Positives = 225/268 (83%), Gaps = 1/268 (0%) Query: 9 LQSLLLGTLAWAIAILIFFPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYLHVNERSGY 68 ++ + L L W IA++IFFPI WMVLT FKTE +A A P IFTPTLE+Y+ V R+ Y Sbjct: 6 MRRVWLTLLGWGIALIIFFPILWMVLTGFKTEAEAIADP-SLIFTPTLESYVAVQARADY 64 Query: 69 FSFAWNSVVISFSATALCLLIAVPAAYSMAFYETQRTKGTLLWMLSTKMLPPVGVLMPIY 128 F FA NSVV++F +T L LLIA+PAAY+MAF T+RTK TLLWMLSTKMLPPVGVL+PIY Sbjct: 65 FKFASNSVVVAFGSTLLALLIAIPAAYAMAFLPTRRTKATLLWMLSTKMLPPVGVLVPIY 124 Query: 129 LLAKSFGLLDTRIALIIIYTLINLPIVVWMIYTYFKDIPKDILEAARLDGATLWQEMVRV 188 L+ + GLLDTR LII+YTL+NLPIVVWM+YT+FKD+P+DILEA R+DGA+ +QE+V + Sbjct: 125 LIFRDLGLLDTRSGLIIVYTLMNLPIVVWMLYTFFKDLPRDILEAGRMDGASTFQEVVYL 184 Query: 189 LLPIAKGGLASTVLLSLILCWNEAFWSLNLTSSKAAPLTALIASYSSPEGLFWAKLSAVS 248 LLP+ G+AST LLS+IL WNEAFWSLNLTSS AAPLTA IAS+SSPEGLFWAKLSA S Sbjct: 185 LLPLTLPGIASTGLLSVILSWNEAFWSLNLTSSNAAPLTAYIASFSSPEGLFWAKLSAAS 244 Query: 249 TLACAPILIFGWISQKQLVRGLSFGAVK 276 T+A APILIFGW++QKQ+VRGL+FGAVK Sbjct: 245 TMAIAPILIFGWLTQKQMVRGLTFGAVK 272 Lambda K H 0.327 0.138 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 272 Length adjustment: 25 Effective length of query: 251 Effective length of database: 247 Effective search space: 61997 Effective search space used: 61997 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory