Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate WP_086511325.1 BZY95_RS18280 diaminobutyrate--2-oxoglutarate transaminase
Query= reanno::Putida:PP_4108 (416 letters) >NCBI__GCF_002151265.1:WP_086511325.1 Length = 421 Score = 177 bits (448), Expect = 7e-49 Identities = 139/414 (33%), Positives = 216/414 (52%), Gaps = 28/414 (6%) Query: 15 PITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAI--QAQATRLTH-YAFNA 71 P+ + RNA + D G+ YIDF+ G G LN GH NP + +A+ + + H F Sbjct: 21 PVVFTKARNARLTDESGREYIDFLAGAGTLNYGHNNPHLKQALLDYLDSDGIVHGLDFWT 80 Query: 72 APHGPYLALMEQL---SQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRAIIAFDGG 128 A YL +E++ + + L G +G A E A+++AR A G+ I++F G Sbjct: 81 AAKRDYLETLEEVILKPRGLDYKVHLPGP---TGTNAVEAAIRLARVAQGRHNIVSFTNG 137 Query: 129 FHGRTLATLNLNGKVAPYKQRVGELP--GPVYHLPYPSADTGVTCEQALKAMDRLFSVEL 186 FHG T+ +L G +++ G +P G + +PY T +L ++L Sbjct: 138 FHGVTMGSLATTGN-RKFREATGGIPLQGSAF-MPYDGYLGEHT--DSLDYFEKLLGDNS 193 Query: 187 AVEDV-AAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAF 245 + D+ AA I E VQGEGG + Q L R C + IL+I+D+IQ+G GRTG+ F+F Sbjct: 194 SGLDLPAAVIVETVQGEGGINVAGLEWLQRLERICRDNDILLIVDDIQAGCGRTGKFFSF 253 Query: 246 PRLGIEPDLLLLAKSIAG-GMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLA 304 GI PD++ +KS++G G+P V+ R EL P G GT+ G ++ A A A++ Sbjct: 254 EHAGITPDIVTNSKSLSGFGLPFAHVLMRPELDKWKP-GQYNGTFRGFNLAFATAAAAMR 312 Query: 305 Q-MTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLT--GVGAMRGIEFANADGSPAP 361 Q D+ +R+ + + R+++ A+ + Y + T G G MRGI+ + G A Sbjct: 313 QYWQDDTFERDVQRKGRVVEDRFQK-IAALIGEYGVKATERGRGLMRGIDVGS--GELAD 369 Query: 362 AQLAKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLAEL 415 AK E +GL++ SG+A +++ L PLTI E L EGLDILE + E+ Sbjct: 370 KITAKAFE----KGLVIETSGQAGEVVKCLCPLTIPDEDLLEGLDILEASVKEV 419 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 421 Length adjustment: 32 Effective length of query: 384 Effective length of database: 389 Effective search space: 149376 Effective search space used: 149376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory