Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_086511383.1 BZY95_RS18600 nucleoside-diphosphate sugar epimerase/dehydratase
Query= SwissProt::Q9ZDJ5 (341 letters) >NCBI__GCF_002151265.1:WP_086511383.1 Length = 655 Score = 148 bits (374), Expect = 3e-40 Identities = 100/290 (34%), Positives = 155/290 (53%), Gaps = 25/290 (8%) Query: 5 KTLMITGGTGSFGNAVLSRFLKSN----IINDIKEIRIFSRDEKKQEDMRIALNNS---K 57 K +++TG GS G+ + + L+ ++ DI E ++ + Q+ +RIA + Sbjct: 282 KVVLVTGAGGSIGSELCRQILRHGPGRLLLLDISEFALYRIE---QDLLRIAAEEGLEVR 338 Query: 58 LKFYIGDVRNYQSIDDAM--HGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAA 115 ++ +G V++ Q + M + V V+HAAA K VP E +E + NV G + +A Sbjct: 339 VEALMGSVQHRQRLTTVMKAYEVQTVYHAAAYKHVPMVEHNVVEGVQNNVFGTLSAARSA 398 Query: 116 INNKVTKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASR 175 I+ V +++STDKAV P N MG +K L E + A AR +S T C+ R+GNV+ S Sbjct: 399 IDAGVETFVLVSTDKAVRPTNVMGTTKRLAELVCQAFARQQSA--TRFCMVRFGNVLGSS 456 Query: 176 GSVIPLFIHQIKQGKELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFV-QKSPAST 234 GSV+PLF QI+ G +T+T P +TRF M++ ++ LV+ A R GD+FV Sbjct: 457 GSVVPLFRQQIQAGGPITVTHPDITRFFMTIPEAAQLVIQAGAMARGGDVFVLDMGEPVR 516 Query: 235 IEVLAKALQEIFGSK----------NAIRFIGTRHGEKHYESLVSSEDMA 274 I LA+ + + G K AI + G R GEK YE L+ +D+A Sbjct: 517 IADLARQMVRLSGLKVRDERNPDGDIAIAYSGLRPGEKLYEELLVGDDVA 566 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 655 Length adjustment: 33 Effective length of query: 308 Effective length of database: 622 Effective search space: 191576 Effective search space used: 191576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory