Align alcohol dehydrogenase (quinone) (EC 1.1.5.5) (characterized)
to candidate WP_086511538.1 BZY95_RS19425 methanol/ethanol family PQQ-dependent dehydrogenase
Query= BRENDA::Q44002 (739 letters) >NCBI__GCF_002151265.1:WP_086511538.1 Length = 607 Score = 296 bits (759), Expect = 2e-84 Identities = 190/560 (33%), Positives = 282/560 (50%), Gaps = 44/560 (7%) Query: 47 IHADDHPGNWMTYGRTYSEQRYSPLDQINRSNVGNLKLAWYLDLDTNRGQEGTPLVI-DG 105 + +P W T Y R+S LDQINR NV L+ W RG EG PL + DG Sbjct: 27 LELQQNPEYWATQLGNYQGNRFSELDQINRDNVSELRSVWQFSTGVLRGHEGGPLYVGDG 86 Query: 106 VMYATTNW-SMMKAVDAAT-GKLLWSYDPRVPGNIADKGCCDTVNRGAAYWNGKVYFGTF 163 +Y T + + + A+D G+++WSY+P + CCDTVNRG AY +G+++ G Sbjct: 87 RLYIHTPFPNKVFALDLEDEGRVVWSYEPDQDSRVIPVMCCDTVNRGLAYADGRLFLGQA 146 Query: 164 DGRLIALDAKTGKLVWSVNTIPPEAELGKQRSYTVDGAPRIAKGRVIIGNGGSEFGARGF 223 D LIALDA++G+L+W V+ + +G+ + + P + VI+G G E+G RG Sbjct: 147 DNTLIALDAESGELLWDVSN--GDHTVGETNTMS----PLVVHDMVIVGISGGEYGIRGH 200 Query: 224 VTAFDAETGKVDWR-FFTAPNPKN--EPDHTASDSVLMNKA---YQTWSPTGAWTRQGGG 277 +TA++ ETG++ WR + T P+ + +P+ T + +A TW P W R GG Sbjct: 201 MTAYNVETGEMVWRGYSTGPDDEVLIDPETTLMLGEPIGEADLGVSTW-PEDEWER--GG 257 Query: 278 GTVWDSIVYDPVADLVYLGVGNGSPWNYKYRS-EGK-GDNLFLGSIVALKPETGEYVWHF 335 G W + YDP DL+Y G GN WN R+ +G+ DN + ++ A P G W + Sbjct: 258 GAPWGWVTYDPDLDLIYYGTGNPGTWNPDQRAVDGEPADNKWAITVFARDPNDGSVKWVY 317 Query: 336 QETPMDQWDFTSVQQIMTLDLPINGETRHVIVHAPKNGFFYIIDAKTGEFISGKNYV-YV 394 Q+ P D+WD+ V + +D+ GE R + + GF +++D +TGE + + + Sbjct: 318 QKVPFDEWDYDGVNENQLIDVEFEGEERKGLAIIDRTGFGFLLDRETGELLVAEKFAPET 377 Query: 395 NWASGLDPKTGRPIYNPDALYTLTGKEWYGI------PGDLGGHNFAAMAFSPKTGLVYI 448 NWA D +TGRP N D Y+ T ++ + P +G N A+SP+TGL+Y Sbjct: 378 NWADSYDMETGRPNVNED--YS-TFRQGVNVNTTDICPTAMGAKNMQPSAYSPRTGLIYA 434 Query: 449 PAQQVPFLY----TNQVGGFTPHPDSWNLGLDMNKVGIPDSPEAKQAFVKDLKGWIVAWD 504 ++ Y T V G P+ +G + + P + ++ G +AWD Sbjct: 435 GINRICMNYEPYETEYVAG-QPY-----VGATLTMMPAP----TENGQMEGRMGSFIAWD 484 Query: 505 PQKQAEAWRVDHKGPWNGGILATGGDLLFQGLANGEFHAYDATNGSDLFHFAADSGIIAP 564 P W VD + G LAT GDL F G G A D NG +L+ F SGII Sbjct: 485 PVAGETVWEVDERFAVWSGALATAGDLAFYGTLEGHVKAVDIENGEELWRFKTPSGIIGN 544 Query: 565 PVTYLANGKQYVAVEVGWGG 584 T++ GKQYVAV G GG Sbjct: 545 VNTFMHEGKQYVAVLSGVGG 564 Lambda K H 0.318 0.137 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1665 Number of extensions: 139 Number of successful extensions: 15 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 607 Length adjustment: 39 Effective length of query: 700 Effective length of database: 568 Effective search space: 397600 Effective search space used: 397600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory