Align 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 (characterized)
to candidate WP_086511658.1 BZY95_RS20055 methylisocitrate lyase
Query= SwissProt::Q8EJW1 (292 letters) >NCBI__GCF_002151265.1:WP_086511658.1 Length = 301 Score = 386 bits (991), Expect = e-112 Identities = 196/293 (66%), Positives = 233/293 (79%), Gaps = 1/293 (0%) Query: 1 MTQ-SAGLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSGAGVANASYGLPDLG 59 MTQ + G RFR AL ++PL IVGT NAY A+MAE+ G QA+YLSG GVANAS+GLPDLG Sbjct: 1 MTQPTPGARFRAALEANRPLPIVGTINAYTAMMAERVGHQAIYLSGGGVANASFGLPDLG 60 Query: 60 MTSMNDVLIDAGRITSATQLPLLVDIDTGWGGAFNIARTIKEFEKIGVAAVHMEDQVSQK 119 MTSMNDV+ DA RI AT LPLLVDIDTGWGGAFNIART+KE ++ GVAAVH+EDQV+QK Sbjct: 61 MTSMNDVVQDAHRICGATDLPLLVDIDTGWGGAFNIARTVKEMQRAGVAAVHLEDQVAQK 120 Query: 120 RCGHRPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDAVAVEGLEAGIERAKAYIAAG 179 RCGHRPNK +VS +EMVDRIKAA DAR DP+F ++ARTDA EGL+A IERA A I AG Sbjct: 121 RCGHRPNKEIVSKQEMVDRIKAAADARIDPDFYLIARTDAFQKEGLDAAIERANACIEAG 180 Query: 180 ADMIFAEALTELDQYRHFKAQVKAPILANMTEFGQTQLFNKEELAQAGADMVLYPLGTFR 239 AD IFAEA+ LD YR F +V APILAN+TEFG T LF ++EL + G MVLYPL FR Sbjct: 181 ADAIFAEAVHTLDDYRAFCERVDAPILANITEFGATPLFTQQELGEVGCRMVLYPLSAFR 240 Query: 240 AANQAALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFEDKLDQLFSQDK 292 A N AALKV +++ GHQR+V++ MQTR +LY +L YHAFE KLD LF++++ Sbjct: 241 AMNAAALKVYRSIHEKGHQRDVVELMQTRDELYDFLNYHAFEQKLDALFAENQ 293 Lambda K H 0.319 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 301 Length adjustment: 26 Effective length of query: 266 Effective length of database: 275 Effective search space: 73150 Effective search space used: 73150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_086511658.1 BZY95_RS20055 (methylisocitrate lyase)
to HMM TIGR02317 (prpB: methylisocitrate lyase (EC 4.1.3.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02317.hmm # target sequence database: /tmp/gapView.5859.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02317 [M=285] Accession: TIGR02317 Description: prpB: methylisocitrate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-131 423.1 0.9 2.8e-131 422.9 0.9 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086511658.1 BZY95_RS20055 methylisocitrate l Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086511658.1 BZY95_RS20055 methylisocitrate lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.9 0.9 2.8e-131 2.8e-131 2 284 .. 7 290 .. 6 291 .. 0.99 Alignments for each domain: == domain 1 score: 422.9 bits; conditional E-value: 2.8e-131 TIGR02317 2 gkalrellkkedilqipGainalvallaekaGfeavYlsGaalaa.slglPDlglttleevaeearrit 69 g+++r++l+++ +l i+G+ina++a++ae++G++a+YlsG+++a+ s+glPDlg+t++++v+++a+ri lcl|NCBI__GCF_002151265.1:WP_086511658.1 7 GARFRAALEANRPLPIVGTINAYTAMMAERVGHQAIYLSGGGVANaSFGLPDLGMTSMNDVVQDAHRIC 75 689*****************************************989********************** PP TIGR02317 70 rvtklpllvDaDtGfGealnvartvkeleeagvaavhieDqvapkkCGhldgkelvskeemvkkikaav 138 +t+lpllvD+DtG+G+a+n+artvke+++agvaavh+eDqva+k+CGh+++ke+vsk+emv++ikaa+ lcl|NCBI__GCF_002151265.1:WP_086511658.1 76 GATDLPLLVDIDTGWGGAFNIARTVKEMQRAGVAAVHLEDQVAQKRCGHRPNKEIVSKQEMVDRIKAAA 144 ********************************************************************* PP TIGR02317 139 kakkdedfvliaRtDaraveGldaaieRakaYveaGadaiftealeseeefrefakavkvpllanmtef 207 +a+ d+df+liaRtDa eGldaaieRa+a +eaGadaif+ea+++++++r f+++v++p+lan+tef lcl|NCBI__GCF_002151265.1:WP_086511658.1 145 DARIDPDFYLIARTDAFQKEGLDAAIERANACIEAGADAIFAEAVHTLDDYRAFCERVDAPILANITEF 213 ********************************************************************* PP TIGR02317 208 GktplltadeleelgykiviyPvtalRaalkaaekvyeelkkkGtqkelldklqtRkelYellgyedye 276 G tpl+t +el e+g ++v+yP++a+Ra++ aa kvy+++++kG q+++++ +qtR+elY+ l+y+++e lcl|NCBI__GCF_002151265.1:WP_086511658.1 214 GATPLFTQQELGEVGCRMVLYPLSAFRAMNAAALKVYRSIHEKGHQRDVVELMQTRDELYDFLNYHAFE 282 ********************************************************************* PP TIGR02317 277 kkdkelfk 284 +k++ lf+ lcl|NCBI__GCF_002151265.1:WP_086511658.1 283 QKLDALFA 290 ***99985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (301 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.18 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory