Align glycolaldehyde oxidoreductase medium subunit (characterized)
to candidate WP_086511683.1 BZY95_RS20185 xanthine dehydrogenase small subunit
Query= metacyc::MONOMER-18072 (282 letters) >NCBI__GCF_002151265.1:WP_086511683.1 Length = 490 Score = 119 bits (298), Expect = 1e-31 Identities = 84/269 (31%), Positives = 128/269 (47%), Gaps = 9/269 (3%) Query: 5 DFTYVRVSSSEEATKFLESHDDARPLAGGQSLIPMLKLRVISPNYIVDLNPITSLSYVRS 64 D +++ S+ T L+ H AR +AG L R+ +++D+ + L+ + Sbjct: 192 DAAFLQPSTLAALTDCLKRHPKARLVAGATDLWLESTQRLARFEHVIDVTRVAELNDIDD 251 Query: 65 SF-----NSTKIGALTRYNEILKNDLVRVNVPLLHQAVRVVGDMQVRNLGTIGGSAANAD 119 + + IGA Y+ + L+ + + +G QVRN GT+GG+ ANA Sbjct: 252 ATLEDGRSGWWIGAAVTYSRL--EPLLEAHYDAFAHLLHRLGSQQVRNRGTLGGNVANAS 309 Query: 120 PSADIPTVLTALNAEIILSSASGNRSVNALDFFKGAFATDLRKGEIISEIVLPNLEGYRT 179 P D P VL AL + + L G R + DFF T LR+GE I I LP E +T Sbjct: 310 PIGDTPPVLLALGSRLRLVGPEGERELPLDDFFLDYKRTALREGEAIRAIFLPRPEAGQT 369 Query: 180 --IYKKVVRRAGDFALVSLALAIKLRQNEIEDIRLAYGGVGERPFRALEVEKSVMGKRLN 237 ++K RR D + V A A +L + D+RLA+GG+ P RA E ++ GK + Sbjct: 370 LKVWKLSKRREDDISAVLGAFAYRLENGVMRDVRLAFGGMAAIPKRAANAEAALEGKAPD 429 Query: 238 DELVEEIVSKVSSQVNPPSDTRGSSWYRR 266 + +S+ P SD RGS+ YRR Sbjct: 430 LAAFQAAREALSNDFQPMSDVRGSAHYRR 458 Lambda K H 0.317 0.134 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 490 Length adjustment: 30 Effective length of query: 252 Effective length of database: 460 Effective search space: 115920 Effective search space used: 115920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory