Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.110) (characterized)
to candidate WP_086511792.1 BZY95_RS20765 glycolate oxidase subunit GlcD
Query= BRENDA::H6LBS1 (466 letters) >NCBI__GCF_002151265.1:WP_086511792.1 Length = 501 Score = 218 bits (554), Expect = 5e-61 Identities = 139/452 (30%), Positives = 228/452 (50%), Gaps = 7/452 (1%) Query: 13 AIKELIPAERVFVGTEIGEDFSHDELGSIHSYPEVLIKVTSTEEVSKIMKYAYEHNIPVV 72 A+ + IP + E F D L + P ++ S ++V +++ + +PVV Sbjct: 24 ALLKAIPGMTLLHREEDMRPFECDGLSVYRTLPLLVALPDSLDQVQRLLVECHRLGVPVV 83 Query: 73 VRGSGTGLVGACVPLFGGIMLETTLMNNILELDTENLTVTVEPGVLLMELSKFVEENDLF 132 RG+GTGL +PL G++L + + ILE+D E VEPGV + +S+ L+ Sbjct: 84 TRGAGTGLSAGALPLTHGVLLVMSRFSRILEIDPEARIARVEPGVRNLAISEAASPYGLY 143 Query: 133 YPPDPGEKSA-TIAGNISTNAGGMRAVKYGVTRDYVRGLTVVLANGEIIELGGKIVKNSS 191 Y PDP + A +I GN++ NAGG+ +KYG+T V + V+ GE + LG + ++ Sbjct: 144 YAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNVIKVEVLTIEGERMTLGSDAL-DAP 202 Query: 192 GYSLKDLVIGSEGTLCVITKAILKLLPLPKMTLSLLIPFENISDAAGIVPKIIKSKAIPT 251 G+ L L GSEG L V+T+ +KLLP P++ L+ F+++ A V II + IP Sbjct: 203 GFDLLALFNGSEGMLGVVTEITVKLLPKPEVAKVLMASFDDVEKAGNAVGAIIAAGIIPG 262 Query: 252 AIEFMERQTILFAEDFLGKKFPDSSSNAYILLTFDGNTKEQVEAEYETVANLCLAEGAKD 311 +E M++ I+ AEDF+G +P + A +L DG + V+ + ETV + GA Sbjct: 263 GLEMMDKLAIIAAEDFIGAGYP-VDAEAILLCELDG-VEADVDDDCETVRQVLEKAGATG 320 Query: 312 VYIVDTVERKDSVWSARGAFLEAIKASTTEMDECDVVVPRNRIAEFIEFTHDLAKEMDVR 371 + + W+ R A+ + + D +PR +A ++ DL++ ++ Sbjct: 321 IRQARDDAERARFWAGRKNAFPAVGRMSPDYYCMDGTIPRRELARVLKGISDLSERYGLK 380 Query: 372 IPSFGHAGDGNLHIYVCRDELCQADWEAKLAEAM-DRMYAKALTFEGLVSGEHGIGYAKR 430 + + HAGDGN+H + D + E +AEA+ + + G ++GEHG+G K Sbjct: 381 VANVFHAGDGNMHPLILFD--ANREGELAVAEALGGEILELCVEVGGTITGEHGVGREKI 438 Query: 431 KYLLNDFGTEHLALMAGIKQTFDPKNLLNPKK 462 + F + LA K FDP +LLNP K Sbjct: 439 NQMCAQFRPDELATFRAAKAAFDPHDLLNPGK 470 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 501 Length adjustment: 34 Effective length of query: 432 Effective length of database: 467 Effective search space: 201744 Effective search space used: 201744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory