Align L-talarate dehydratase (EC 4.2.1.156); galactarate dehydratase (EC 4.2.1.42) (characterized)
to candidate WP_086511801.1 BZY95_RS20810 L-fuconate dehydratase
Query= BRENDA::Q8ZL58 (398 letters) >NCBI__GCF_002151265.1:WP_086511801.1 Length = 434 Score = 113 bits (282), Expect = 1e-29 Identities = 96/326 (29%), Positives = 145/326 (44%), Gaps = 58/326 (17%) Query: 113 TKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLL----------------- 155 ++L W G G +A AI A+WD+ AK G P+ KLL Sbjct: 98 SQLRWIGPEKGAIHLATAAIVN---AVWDLWAKTEGKPVWKLLVDMPPEQLIRCLDFRFV 154 Query: 156 -------------------------GAHRDSVQCYNTSGGFLHTPLDQVLKNVVISRENG 190 Y TS G+L D+V + + G Sbjct: 155 TDALTPEEALGLLRRNAAGRADREREMREQGYPAYTTSAGWLGYDDDKVRRLAREALAEG 214 Query: 191 IGGIKLKVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMGRKMEQFNLIW 250 K KVG N ED RR +RE +G E LM+DANQ WD + AI R++ +F+ +W Sbjct: 215 WTHFKQKVGG-NLEEDRRRAQILREEIGWERALMMDANQMWDVDEAIANMRRLAEFDPLW 273 Query: 251 IEEPLDAYDIEGHAQLAAALDT-PIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGIS 309 IEEP DI GHA++ L + +ATGE + +QL+ A D+ Q DA R+GG++ Sbjct: 274 IEEPTSPDDILGHAEIRRRLGSIGVATGEHCHNRVMFKQLLQAGALDYCQVDAARLGGLN 333 Query: 310 PFLKIMDLAAKHGRKLAPH--------FAMEVHL--HLSAAYPLE-PWLEHFEWLNPLFN 358 + ++ LAAKHG + PH + V L +++ + LE LE+ + L+ F Sbjct: 334 EVIVVLLLAAKHGVPVCPHAGGVGLCEYVQHVSLFDYIAVSGSLEGRILEYVDHLHEHFL 393 Query: 359 EQLELRDGRMWISDRHGLGFTLSEQA 384 + +R+GR + G +L ++ Sbjct: 394 HPVTIRNGRYQVPTAPGYSISLHPES 419 Lambda K H 0.319 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 398 Length of database: 434 Length adjustment: 31 Effective length of query: 367 Effective length of database: 403 Effective search space: 147901 Effective search space used: 147901 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory