Align L-fuconate dehydratase; EC 4.2.1.68 (characterized, see rationale)
to candidate WP_086511801.1 BZY95_RS20810 L-fuconate dehydratase
Query= uniprot:D8J108 (425 letters) >NCBI__GCF_002151265.1:WP_086511801.1 Length = 434 Score = 551 bits (1420), Expect = e-161 Identities = 257/425 (60%), Positives = 330/425 (77%), Gaps = 2/425 (0%) Query: 1 MTKITALRVLDVRFPTSQSLDGSDAMNPDPDYSAAYVILDTDNA-ALKGHGLTFTIGRGN 59 MT IT L V D+RFPTS+SLDGSDAMN PDYSA YV L TD L GHGLTFTIGRGN Sbjct: 1 MTTITRLEVQDIRFPTSRSLDGSDAMNAAPDYSATYVTLHTDAGNGLSGHGLTFTIGRGN 60 Query: 60 EICCAAIRAMEHLVVGLELEWIAADMGRFWRHVTS-DSQLRWIGPDKGAIHLATGAVVNA 118 EIC A+ ++ +L+ G L+ I A+MGRFWR +TS DSQLRWIGP+KGAIHLAT A+VNA Sbjct: 61 EICVKAVESLAYLIEGRRLDDITAEMGRFWRELTSGDSQLRWIGPEKGAIHLATAAIVNA 120 Query: 119 AWDLWAKAEGKPVWKLVADMSPEELVRTIDFRYITDCITPDEALALLREKEAGKAERLRV 178 WDLWAK EGKPVWKL+ DM PE+L+R +DFR++TD +TP+EAL LLR AG+A+R R Sbjct: 121 VWDLWAKTEGKPVWKLLVDMPPEQLIRCLDFRFVTDALTPEEALGLLRRNAAGRADRERE 180 Query: 179 LEQEGYPCYTTSAGWLGYEDAKLRRLCQEAIDQGFNHVKLKVGRDLADDKRRVTIAREVL 238 + ++GYP YTTSAGWLGY+D K+RRL +EA+ +G+ H K KVG +L +D+RR I RE + Sbjct: 181 MREQGYPAYTTSAGWLGYDDDKVRRLAREALAEGWTHFKQKVGGNLEEDRRRAQILREEI 240 Query: 239 GPERKLMIDANQVWEVHQAIDWVNQLAFAQPWFIEEPTSPDDVEGHRKIREGIGAVKVAT 298 G ER LM+DANQ+W+V +AI + +LA P +IEEPTSPDD+ GH +IR +G++ VAT Sbjct: 241 GWERALMMDANQMWDVDEAIANMRRLAEFDPLWIEEPTSPDDILGHAEIRRRLGSIGVAT 300 Query: 299 GEMCQNRVLFKQFIMRDAIDVVQIDSCRLGGVNEILAVMLMAAKYGKVVCPHAGGVGLCE 358 GE C NRV+FKQ + A+D Q+D+ RLGG+NE++ V+L+AAK+G VCPHAGGVGLCE Sbjct: 301 GEHCHNRVMFKQLLQAGALDYCQVDAARLGGLNEVIVVLLLAAKHGVPVCPHAGGVGLCE 360 Query: 359 YVQHLSMIDYLCISGSKEGRVTEYVDHLHEHFVDPCVVKNAAYMPPSRPGFSIEMKPQSL 418 YVQH+S+ DY+ +SGS EGR+ EYVDHLHEHF+ P ++N Y P+ PG+SI + P+SL Sbjct: 361 YVQHVSLFDYIAVSGSLEGRILEYVDHLHEHFLHPVTIRNGRYQVPTAPGYSISLHPESL 420 Query: 419 EQYRF 423 ++ + Sbjct: 421 SRHAY 425 Lambda K H 0.322 0.137 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 625 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 434 Length adjustment: 32 Effective length of query: 393 Effective length of database: 402 Effective search space: 157986 Effective search space used: 157986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory