Align lactaldehyde dehydrogenase (EC 1.2.1.22); D-glyceraldehyde dehydrogenase (NADP+) (EC 1.2.1.89) (characterized)
to candidate WP_086511804.1 BZY95_RS20815 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::P25553 (479 letters) >NCBI__GCF_002151265.1:WP_086511804.1 Length = 495 Score = 335 bits (859), Expect = 2e-96 Identities = 175/462 (37%), Positives = 275/462 (59%), Gaps = 1/462 (0%) Query: 10 YIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERA 69 YIDG +V +A I+VV+PA++ + +P R+AI++A+RA P+W+A A ERA Sbjct: 26 YIDGSWVDASDEAIIEVVDPASDTRLGSVPRLTQAQVREAIESADRALPQWKARTAKERA 85 Query: 70 SWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQS 129 + LR+ +++ ++ E GK A E+ + + +I++ AE A+R G++I + Sbjct: 86 AILRRWYELCMAHQEDLARILTLEQGKPLAEARGEITYGSAFIEWFAEEAKRIYGDVIPA 145 Query: 130 DRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFA 189 I++ K +GV I PWNFP +I RK A A+ G T+V+KP+ TP +A+A A Sbjct: 146 HAGDRRIVVTKEPVGVVAAITPWNFPNAMITRKAAAAMAAGCTVVVKPASSTPFSALALA 205 Query: 190 KIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNITKVC 249 ++ + G+PRGV N+V G TVG EL NP V +S TGS G+ ++A A+ + KV Sbjct: 206 ELAERAGVPRGVLNVVTGSARTVGDELTANPLVRKLSFTGSTEVGKVLLAACAQTVKKVS 265 Query: 250 LELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEAM 309 +ELGG AP I+ DDADL+ AV ++ S+ N+GQ C CA R++V + IY F RL +A+ Sbjct: 266 MELGGNAPFIIFDDADLDQAVAGVMASKFRNTGQTCVCANRIFVHERIYADFAERLAQAV 325 Query: 310 QAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVAFGGKAVEGKGYYYPPTL 369 A + GN E + +GPLI+ AA+ +VE+ +A A E GA V GG+ G ++ PT+ Sbjct: 326 AAQRVGNGLEEG-VTLGPLIDPAAVAKVEEHIADARERGASVYLGGQRHALGGNFFEPTI 384 Query: 370 LLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKG 429 L DV + +M+EETFGPV P++ F ++ + +AND+ YGL S YT+++ + + Sbjct: 385 LTDVSSDARLMNEETFGPVAPLLRFSDEQEVVRLANDTPYGLASYFYTRDVGRVWRVAEA 444 Query: 430 LKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQ 471 L+ G IN + G ++SGIG K+G+ +Y++ Sbjct: 445 LECGIVGINEGIISSELAPFGGVKESGIGREGSKYGIEDYIE 486 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 570 Number of extensions: 30 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 495 Length adjustment: 34 Effective length of query: 445 Effective length of database: 461 Effective search space: 205145 Effective search space used: 205145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory