Align Protein containing DUF162 (characterized, see rationale)
to candidate WP_086511824.1 BZY95_RS20925 lactate utilization protein C
Query= uniprot:E4PLR7 (223 letters) >NCBI__GCF_002151265.1:WP_086511824.1 Length = 222 Score = 184 bits (466), Expect = 2e-51 Identities = 100/219 (45%), Positives = 132/219 (60%), Gaps = 4/219 (1%) Query: 1 MSARANILGKLRNSLAGTTPRPDEFDERLVTAPWRYAPEDRIERLRSLMEAVHTEVHPCR 60 MSAR NIL +LR G P + V + ++ ++R+ R + +VH EV Sbjct: 1 MSARDNILKRLRERTDGPLTAPQS--DFAVVSGRGWSQQERLARFERWITSVHGEVIHTS 58 Query: 61 SDNWPELVAELLNKRNLTNLLCAPSKEHGRALQAYFEATEQKVELLAYDQPVEAWKEELF 120 D+W +AELL + + L A +EH A +A E V L+ D+ +E W+ E F Sbjct: 59 RDDWTRALAELLETKGIRRL--ALGREHPVAAEARSALAEGDVILIDADRDIETWRHEQF 116 Query: 121 WSVEASLTGTLGGIAATGTLVLWPDCHEPRLMSLVPPVHIALLKASEIHDNLYDMMVAQD 180 +A LT T G IA TG+L LWP EPRL+SLVPP+HIA+L A I D +D++ A Sbjct: 117 HDTDAGLTSTRGAIAETGSLWLWPTPDEPRLLSLVPPIHIAVLDADTIEDTFFDVVEAHG 176 Query: 181 WAAGLPTNVLLVSGPSKTADIEQVLAYGAHGPRELIVLV 219 WA G+PTN LL+SGPSKTADIEQ LAYG HGPREL+VL+ Sbjct: 177 WAGGMPTNALLISGPSKTADIEQTLAYGVHGPRELVVLL 215 Lambda K H 0.317 0.133 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 222 Length adjustment: 22 Effective length of query: 201 Effective length of database: 200 Effective search space: 40200 Effective search space used: 40200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory