Align Iron-sulfur cluster-binding protein (characterized, see rationale)
to candidate WP_086511825.1 BZY95_RS20930 iron-sulfur cluster-binding protein
Query= uniprot:Q726S3 (717 letters) >NCBI__GCF_002151265.1:WP_086511825.1 Length = 489 Score = 271 bits (694), Expect = 4e-77 Identities = 144/382 (37%), Positives = 215/382 (56%), Gaps = 1/382 (0%) Query: 6 TLKEYRKELQESLDNEFLRNAMDKFAVAYRASRANAFKDIDEKAIIAEVADAKDHAAKNM 65 T +E+ ++ ++L N +R K A R + F D D + + A+ + A + Sbjct: 10 TPREFHRQAHDALGNPQIRANFRKAMDGLMAKRRDVFSDWDLETLRELGANIRLRALAKL 69 Query: 66 DTLYAQFKAEAEKRGVKVHLARTAAEANEIIARIARDNNCKKAIKSKSMTAEETHLNHRL 125 L + +A + G++VH A EA II I + + K IK KSM +EE HLN L Sbjct: 70 PDLLERLEANCQANGIQVHWAENGDEACRIIREICQRHGAKAVIKGKSMVSEEMHLNAHL 129 Query: 126 EEDNVEVIETDLGEWIIQMRHEGPSHMVMPAIHLSRYQVADLFSEVTKQKQEVDIQRLVK 185 EE +E +E+DLGE+++Q+ + PSH++MPAIHL+ +++++ T ++ D+ + Sbjct: 130 EEAGIEALESDLGEYLVQLNEQTPSHIIMPAIHLNTDEISEIMHTRTGTERTRDVDTMTA 189 Query: 186 VARRELRTHFATADMGISGANFAVAETGTIGLVTNEGNARLVTTLPRVHVALAGLDKLVP 245 AR +LR F AD+GISG NFAVAETGT+ LV NEGN R+ T +P VH+A+ G++K+V Sbjct: 190 AARAQLRERFMAADVGISGVNFAVAETGTLCLVENEGNGRMTTAVPPVHIAVTGIEKVVE 249 Query: 246 TLHDALRSLKVLPRNATGQAITSYVTWIGGANECEACVDGRKEMHIVFLDNGRRALAEDP 305 L D +L R+ATGQ +T+Y I + DG E+H+V +D+GR + +D Sbjct: 250 HLRDVPPLYALLTRSATGQHVTTYFNMISSPRKLGE-HDGPNEVHLVLVDSGRSNIYQDD 308 Query: 306 LFSQVLRCVRCGACANVCPVYRLVGGHKMGHIYIGAIGLILTYFFHGRDKARNLVQNCIN 365 LRC+RCGAC N CPVY VGGH G Y G IG IL G + ++L Sbjct: 309 ELLDTLRCIRCGACMNHCPVYTRVGGHTYGTTYPGPIGSILMPHMMGLEATKDLPTASSL 368 Query: 366 CESCKHICAGGIDLPRLIKEIR 387 C +C +C I +P L+ +R Sbjct: 369 CGACGEVCPVKIPIPDLLVRLR 390 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 775 Number of extensions: 35 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 489 Length adjustment: 37 Effective length of query: 680 Effective length of database: 452 Effective search space: 307360 Effective search space used: 307360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory