Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate WP_086511943.1 BZY95_RS21560 enoyl-CoA hydratase-related protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2986 (356 letters) >NCBI__GCF_002151265.1:WP_086511943.1 Length = 263 Score = 73.2 bits (178), Expect = 7e-18 Identities = 63/205 (30%), Positives = 96/205 (46%), Gaps = 10/205 (4%) Query: 7 EVLAEVRNHIGHLTLNRPAGLNALTLDMVRNLHRQLDAWAQDSQVHAVVLRGAGEKAFCA 66 ++L +V + + +T+NRP NA L + D V +VL GAG+KAFC Sbjct: 10 DILYDVNDGVATITINRPERYNAFRGQTCMELLDAFNCAGWDKSVGVIVLAGAGDKAFCT 69 Query: 67 GGDIRSLHDSFKSGDTLHEDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQGADL 126 GGD +S H+ G + VEE L I KPV+A + GF +GGG L DL Sbjct: 70 GGD-QSAHEGQYDGRGI-IGLPVEE--LQTLIRQVPKPVIARVQGFAIGGGHVLALVCDL 125 Query: 127 RVVTEKSRLAMPEVGIGYFPDVGGSYFLSRIPGE-LGIYLGVSGVQIRAADALYCGLADW 185 + +E + +G G+ +++R+ GE + + AA AL GL + Sbjct: 126 TIASENAVFGQVGPKVGSVDPGFGTAYMARVIGEKRAREIWYLCRKYSAAQALEWGLCNA 185 Query: 186 YLESGKLGVLDEKLDQLEWHDTPLK 210 + + K LDE++ Q W D L+ Sbjct: 186 VVPADK---LDEEVRQ--WCDEILE 205 Lambda K H 0.322 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 263 Length adjustment: 27 Effective length of query: 329 Effective length of database: 236 Effective search space: 77644 Effective search space used: 77644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory