Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate WP_086511946.1 BZY95_RS21575 enoyl-CoA hydratase
Query= BRENDA::D3RXI0 (252 letters) >NCBI__GCF_002151265.1:WP_086511946.1 Length = 257 Score = 115 bits (288), Expect = 9e-31 Identities = 85/259 (32%), Positives = 133/259 (51%), Gaps = 12/259 (4%) Query: 3 YKKIKVEKDERVARIKIANPPV-NVLDMETMKEI---ISAIDEVEGVDVIVFSGEGKSFS 58 Y+ ++VE+ V I + P N L+ M+E+ + A ++ + + +V +G + F+ Sbjct: 2 YENLQVERTGAVGVITLYRPDAHNALNGALMRELGCALRAFEQDDAIGAMVITGGERVFA 61 Query: 59 AGAEIKEHFPDKAPEMIRWFTQLI----DKVLRCKAITVAAVKGFALGGGFELAIACDFV 114 AGA+IKE E + + LI ++V RC+ +AAV G ALGGG ELA+ CD + Sbjct: 62 AGADIKEIQSLTFSET--YLSDLITSDWEEVTRCRKPVIAAVAGMALGGGCELAMMCDLI 119 Query: 115 LASKNAKLGVPEITLAHYPPV-AIALLPRMIGWKNAYELILTGEAITAERAFEIGLVNKV 173 +A+ A+ G PEI + P L R IG A +L LTG + A+ A GLV++V Sbjct: 120 IAADTARFGQPEIKVGTLPGAGGTQRLTRAIGKAKAMDLCLTGRLMAADEAERSGLVSRV 179 Query: 174 FEDENFEESVNDFVNSLLEKSSVALRLTKKALLFSTEKEYLSLFDVINDVYLSQLVKSED 233 E + + S+VA+RL K+A+ + E L+ L +ED Sbjct: 180 VPAERLLDEAMTAAAQVASMSAVAVRLNKEAVERAQETT-LAEGVRFERRLLHASFATED 238 Query: 234 AVEGLKAFLEKRKPEWKGR 252 EG++AF+EKR P W+ R Sbjct: 239 QKEGMQAFIEKRPPVWRHR 257 Lambda K H 0.318 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 257 Length adjustment: 24 Effective length of query: 228 Effective length of database: 233 Effective search space: 53124 Effective search space used: 53124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory