Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_086511946.1 BZY95_RS21575 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_002151265.1:WP_086511946.1 Length = 257 Score = 341 bits (874), Expect = 1e-98 Identities = 172/256 (67%), Positives = 202/256 (78%) Query: 3 YENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSEKAFA 62 YEN+ VE G VG++TL RP A NALN ALM ELG ALR F+ DDAIGA+V+TG E+ FA Sbjct: 2 YENLQVERTGAVGVITLYRPDAHNALNGALMRELGCALRAFEQDDAIGAMVITGGERVFA 61 Query: 63 AGADIGMMSTYTYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDIIFA 122 AGADI + + T+ + Y D IT +WE V RKP+IAAVAG ALGGGCELAMMCD+I A Sbjct: 62 AGADIKEIQSLTFSETYLSDLITSDWEEVTRCRKPVIAAVAGMALGGGCELAMMCDLIIA 121 Query: 123 ADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRVIP 182 ADTA+FGQPEIK+G +PGAGGTQRL RA+ KAKAMDLCLT R M A EAER+GLVSRV+P Sbjct: 122 ADTARFGQPEIKVGTLPGAGGTQRLTRAIGKAKAMDLCLTGRLMAADEAERSGLVSRVVP 181 Query: 183 AASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQKE 242 A L+DEA+ AAA +A + AV + KE+V RA ETTLAEGV FERRL H+ FATEDQKE Sbjct: 182 AERLLDEAMTAAAQVASMSAVAVRLNKEAVERAQETTLAEGVRFERRLLHASFATEDQKE 241 Query: 243 GMAAFVEKRKPVFKHR 258 GM AF+EKR PV++HR Sbjct: 242 GMQAFIEKRPPVWRHR 257 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory