Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (characterized)
to candidate WP_086511947.1 BZY95_RS21580 enoyl-CoA hydratase-related protein
Query= SwissProt::P94549 (258 letters) >NCBI__GCF_002151265.1:WP_086511947.1 Length = 298 Score = 162 bits (411), Expect = 6e-45 Identities = 94/198 (47%), Positives = 125/198 (63%), Gaps = 9/198 (4%) Query: 2 NAISLAVDQFVAVLTIHNPPANALSSRILEELSSCLDQCETDAGVRSIIIHGEGRFFSAG 61 N ++L ++T+ +PP NALS + L + LD D V I++ GR FSAG Sbjct: 3 NPVTLTRHGNCGLITLFSPPVNALSQAVRSGLVAALDAALEDPQVAWILLQSGGRCFSAG 62 Query: 62 ADIKEFTSLKGNEDSSLLAERGQQLMERIESFPKPIIAAIHGAALGGGLELAMACHIRIA 121 ADIKEF S +L E +++ IE PKP++A +HG +LGGGLELAMACH R+A Sbjct: 63 ADIKEFGK---PPQSPVLPE----VIDAIEDSPKPVVAWLHGVSLGGGLELAMACHYRLA 115 Query: 122 AEDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALELIGSGEPISGKEALDLGLVSIGAK 181 A DA+ GLPE+ LG+IPG GTQRLPR +G ALE+I SGEPI ++A +LGLV G Sbjct: 116 APDARFGLPEVKLGLIPGAGGTQRLPRLIGLEAALEMILSGEPIGTRQAHELGLVD-GVA 174 Query: 182 DEAEVIEKAK-ALAAKFA 198 D+ E A+ A+AA+ A Sbjct: 175 DQGHTPEAARLAMAAELA 192 Lambda K H 0.315 0.134 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 258 Length of database: 298 Length adjustment: 25 Effective length of query: 233 Effective length of database: 273 Effective search space: 63609 Effective search space used: 63609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory