Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_086511953.1 BZY95_RS21615 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_002151265.1:WP_086511953.1 Length = 256 Score = 176 bits (447), Expect = 3e-49 Identities = 92/249 (36%), Positives = 147/249 (59%), Gaps = 4/249 (1%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 ILEV+N+ K F G A+ DVNL V+E +HA+IGPNGAGK+T+ N L L P G +++ Sbjct: 6 ILEVRNLTKEFRGFTAVDDVNLQVQEGHIHALIGPNGAGKTTVFNLLTKFLPPTRGEILY 65 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQ 122 GK + G EI ++G+ R FQ +FG ++ +EN+ + +R + + Sbjct: 66 RGKPITGMKANEIARLGLVRSFQISAVFGHMTAMENVRVA--LQRPMGTSFHFWKSERSL 123 Query: 123 RDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARA 182 + ++A +LEE+ + + + M G KR LE+ L+ +P ++LLDEPT GM Sbjct: 124 DHLNDRAIELLEEVGLREYADVLTVEMPYGRKRALEVATTLAMDPTMMLLDEPTQGMGAE 183 Query: 183 DTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPKV 242 D + ++L++++ R T+ ++EH++ VV L DRITVLA+G L E D + +P+V Sbjct: 184 DVDRIVELVRRVAKGR--TVLMVEHNLSVVSRLCDRITVLARGAVLAEGDYATVSADPRV 241 Query: 243 REAYLGESA 251 +EAY+G A Sbjct: 242 KEAYMGSDA 250 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 256 Length adjustment: 24 Effective length of query: 227 Effective length of database: 232 Effective search space: 52664 Effective search space used: 52664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory