Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_089299656.1 CHB84_RS00960 KR domain-containing protein
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_900188115.1:WP_089299656.1 Length = 252 Score = 253 bits (645), Expect = 3e-72 Identities = 138/255 (54%), Positives = 173/255 (67%), Gaps = 3/255 (1%) Query: 1 MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADI 60 M ++ IV+G ASGLG ATA L GA+V +DL A A E D + D+ Sbjct: 1 MELSQTAAIVTGGASGLGGATATALAGKGARVFALDL---AEPIAAAERIDGITYVETDV 57 Query: 61 SDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFN 120 +D + Q+AVD A A L +VNCAGI + ++L K+G H L F KV+ VNLIG+FN Sbjct: 58 TDPEQVQAAVDTAAGAGVPLRTVVNCAGIGPSARILSKKGTHDLDLFRKVVEVNLIGTFN 117 Query: 121 LLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELA 180 + LAA A+ + +RGV+INTASIAAYDGQIGQAAYAASKG + L LPAAR+LA Sbjct: 118 VTTLAAEAIGKTEPLTDEQRGVVINTASIAAYDGQIGQAAYAASKGGVVGLNLPAARDLA 177 Query: 181 RFGIRVMTIAPGIFETPMMAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIENSMLN 240 GIRV+TIAPGI +TPM+A + ++VRA LAAGVPFP RLGRP EYA L ++ + LN Sbjct: 178 SAGIRVLTIAPGIIDTPMLATVGEDVRAGLAAGVPFPKRLGRPDEYAQLVLDLVGHDYLN 237 Query: 241 GEVIRLDGALRMAAK 255 GEVIRLDG+LRMA + Sbjct: 238 GEVIRLDGSLRMAPR 252 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory