Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate WP_089299960.1 CHB84_RS03210 acetolactate synthase small subunit
Query= BRENDA::P9WKJ3 (168 letters) >NCBI__GCF_900188115.1:WP_089299960.1 Length = 168 Score = 219 bits (559), Expect = 1e-62 Identities = 113/160 (70%), Positives = 136/160 (85%) Query: 5 THTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATECKDRSRMTIVVSAEDTPLEQIT 64 THTLSVLVE+KPGVLARVA LFSRRGFNI+SLAVG TE + SRMTIVV+ E+ PLEQ+T Sbjct: 3 THTLSVLVENKPGVLARVAGLFSRRGFNIDSLAVGPTENPEISRMTIVVAVEELPLEQVT 62 Query: 65 KQLNKLINVIKIVEQDDEHSVSRELALIKVQADAGSRSQVIEAVNLFRANVIDVSPESLT 124 KQLNKL+NVIKIVE ++ SV REL L K++ADA RSQV+E V+LFRA V+DVSPE++T Sbjct: 63 KQLNKLVNVIKIVELEEPSSVQRELLLAKIRADATVRSQVLEIVDLFRAKVVDVSPEAVT 122 Query: 125 VEATGNRGKLEALLRVLEPFGIREIAQSGMVSLSRGPRGI 164 +EATG K+ ALLR+LEP+GIRE+ QSGMV++ RGPR I Sbjct: 123 IEATGPVDKINALLRMLEPYGIRELVQSGMVAVGRGPRSI 162 Lambda K H 0.315 0.131 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 168 Length adjustment: 18 Effective length of query: 150 Effective length of database: 150 Effective search space: 22500 Effective search space used: 22500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_089299960.1 CHB84_RS03210 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.19777.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.19777.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.