Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_089299966.1 CHB84_RS03240 FAA hydrolase family protein
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_900188115.1:WP_089299966.1 Length = 258 Score = 125 bits (314), Expect = 1e-33 Identities = 85/265 (32%), Positives = 130/265 (49%), Gaps = 27/265 (10%) Query: 28 DGDLGLLYSNGERITARVVAAPWTSSPASTSSPRVLTVQTLLSPLAPTDVPAIRGMGLQY 87 DGD+ +G T +A +P T LL+P+ PT + A+ G Y Sbjct: 18 DGDV-----DGGSATVHEIAEHPFGTPNHTGRSWPYDEVRLLAPILPTKIIAV---GKNY 69 Query: 88 SGDPAN-PQDKPPVACLFFKASQALAGPGDDIVLPRLARDEKNDYEVELCVVLGKDAKDV 146 + A + P +F K + ++ GPG I LP A + D+E EL VV+G+ ++V Sbjct: 70 AEHAAEFDSEVPETPVIFMKPNTSVTGPGAPIKLP--ASSTRVDFEGELAVVIGQPIRNV 127 Query: 147 DEKDAMSFVGGYCVVNDVSSRGLCAKGGQWGMGKSYDTWCPFGPCLVSPSALGADPHKLT 206 A + + GY + NDV++R GQW K YD++CP GP + + DP L Sbjct: 128 PASKAPAAIRGYTIANDVTARDQQRADGQWTRAKGYDSFCPLGPWIET----DVDPADLE 183 Query: 207 ITTHVNGKLAQKGNTADLVLKIPELIARLSHGTTLQAGSLILTGSPIALGRKAPGDAVEQ 266 I T V+G++ Q +TA +V +PEL+ +SH TL G +ILTG+P +G Sbjct: 184 IRTDVDGEVKQDSHTAKMVHTVPELVQFVSHVMTLLPGDVILTGTPEGVGP--------- 234 Query: 267 SPFMKDGDEIRCFVEGCGTLINSVR 291 + +G + V+G GTL N V+ Sbjct: 235 ---ITEGQSVSITVDGIGTLTNPVQ 256 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 258 Length adjustment: 26 Effective length of query: 282 Effective length of database: 232 Effective search space: 65424 Effective search space used: 65424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory