Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_089301200.1 CHB84_RS09725 3-oxoacyl-ACP reductase FabG
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_900188115.1:WP_089301200.1 Length = 251 Score = 139 bits (350), Expect = 6e-38 Identities = 90/262 (34%), Positives = 144/262 (54%), Gaps = 28/262 (10%) Query: 4 KDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACAD-LGSSTEVQGYAL-- 60 + + ++TG A G+G A+A AQ G + ++D+D E +C + + + T G A+ Sbjct: 3 QSRTAIVTGAARGIGAAIAVRLAQDGFAVGVVDLD----ESSCTETIAAITSAGGRAIAV 58 Query: 61 --DITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVI 118 D++ DV A + E+ G VLVNNAGI RD +L K MS + + +V+ Sbjct: 59 GADVSSSADVEAAVRRVTEELGAPTVLVNNAGITRDNLLFK---------MSDEDWDAVM 109 Query: 119 NVNLTGTFLCGREAAAAMIESGQAGVIVNISSLAKAGNVGQSNYAASKAGVAAMSVGWAK 178 V+L G+FL R A E+G G +VN+SS++ GN GQ+NY+ +KAG+ + A Sbjct: 110 GVHLRGSFLMSRAVQAHQTEAGW-GRVVNLSSVSALGNRGQANYSTAKAGLQGFTKTLAV 168 Query: 179 ELARYNIRSAAVAPGVIATEMTAAMKPEALERLE-------KLVPVGRLGHAEEIASTVR 231 EL ++ + + A+APG I +EMTAA E + +PV R+G +IA+TV Sbjct: 169 ELGKFGVTANAIAPGFIESEMTAATAERVGVPYEDFKKGAAEQIPVRRVGQPSDIAATVS 228 Query: 232 FII--ENDYVNGRVFEVDGGIR 251 F++ E +++G+V + GG R Sbjct: 229 FLVSEEAGFISGQVIYIAGGPR 250 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 7 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 251 Length adjustment: 24 Effective length of query: 228 Effective length of database: 227 Effective search space: 51756 Effective search space used: 51756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory