Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate WP_089302006.1 CHB84_RS13775 thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha
Query= metacyc::MONOMER-11683 (330 letters) >NCBI__GCF_900188115.1:WP_089302006.1 Length = 331 Score = 150 bits (380), Expect = 3e-41 Identities = 110/310 (35%), Positives = 161/310 (51%), Gaps = 8/310 (2%) Query: 10 GLTDQEAVDMYRTMLLARKIDERMWLLNRSGKIP-FVISCQGQEAAQVGAAFALDREMDY 68 GL Q + YRTM R +ER+ SG IP FV G+EA+ G LD + D Sbjct: 12 GLDAQRLREAYRTMRTIRAFEERLHEEFASGDIPGFVHLYAGEEASATGVCMHLD-DRDS 70 Query: 69 VLPYYRDMGVVLAFGMTAKDLMMSGFAKAADPNSG-GRQMPGHFGQKKNRIVTGSSPVTT 127 + +R G +A G+ K +M + + G G M H ++ + V Sbjct: 71 IASTHRGHGHCIAKGVDVKAMMAEIYGRRTGACQGKGGSM--HIADLSKGMLGANGIVGG 128 Query: 128 QVPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAI 187 P G ALA + + FG+G+SNQG E N A+V LP IF+ ENN +A Sbjct: 129 GPPLICGTALASKQQNTGGVGVAFFGDGASNQGTTLESLNLASVWGLPAIFVAENNGFAE 188 Query: 188 SVPYDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETISY 247 + VA +NI+DRA G+G+PGV V+G D V++A EA ERAR G GPTLIE Sbjct: 189 ATASAWSVAADNIADRAAGFGIPGVIVDGFDFFAVHEAAGEAIERARGGGGPTLIEVKFT 248 Query: 248 RLTPHSSDDDDSSYRGREEVEEAKKS-DPLLTYQAYLKETGLLSDEIEQTMLDEIMAIVN 306 R H + D SYR +EV++A+++ D L +++ + TGLL + +++ E+ A+++ Sbjct: 249 RYYGH-FEGDQQSYR-LDEVKQARETVDCLKAFRSRVTGTGLLDEAGLESIDGEVFALID 306 Query: 307 EATDEAENAP 316 A EA+ AP Sbjct: 307 AAVAEAKQAP 316 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 331 Length adjustment: 28 Effective length of query: 302 Effective length of database: 303 Effective search space: 91506 Effective search space used: 91506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory