Align Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit; PCC; EC 6.4.1.3; EC 6.3.4.14 (characterized)
to candidate WP_089302566.1 CHB84_RS16745 acetyl-CoA carboxylase biotin carboxylase subunit
Query= SwissProt::I3R7G3 (601 letters) >NCBI__GCF_900188115.1:WP_089302566.1 Length = 457 Score = 417 bits (1072), Expect = e-121 Identities = 222/451 (49%), Positives = 298/451 (66%), Gaps = 4/451 (0%) Query: 4 KVLVANRGEIAVRVMRACEELGVRTVAVYSEADKHGGHVRYADEAYNIGPARAADSYLDH 63 ++LVANRGEIAVR++RA +LG+ TVAV S+AD HVR AD IGPA A SYL Sbjct: 3 RLLVANRGEIAVRIIRAARDLGIETVAVCSDADTEAKHVRLADAVMPIGPAPATKSYLVG 62 Query: 64 ESVIEAARKADADAIHPGYGFLAENAEFARKVEDSEFTWVGPSADAMERLGEKTKARSLM 123 +++++AAR A ADA+HPGYGFL+E AEFA V D+ T+VGP A +E++G+K +AR + Sbjct: 63 DAIVDAARGAGADAVHPGYGFLSERAEFAAAVADAGLTFVGPEASVIEQMGDKVRARKVA 122 Query: 124 QDADVPVVPGTTEPADSAEDVKAVADDYGYPVAIKAEGGGGGRGLKVVHSEDEVDGQFET 183 +A VP VPGTT+ + A D GYPV +KA GGGGRG++VV +E E+ +F Sbjct: 123 MEAGVPTVPGTTDGTADVDAAVTAAADIGYPVMLKAAAGGGGRGIRVVDNEAELASEFPA 182 Query: 184 AKREGEAYFDNASVYVEKYLEAPRHIEVQILADEHGNVRHLGERDCSLQRRHQKVIEEAP 243 A E F + +Y+E+++ + RH+EVQ+L D V HL ER+CSLQRR QKVIEEAP Sbjct: 183 ASAEAAKAFGDGQMYLERFVRSSRHVEVQVLGDGKDAV-HLFERECSLQRRRQKVIEEAP 241 Query: 244 SPALSEDLRERIGEAARRGVRAAEYTNAGTVEFLVED--GEFYFMEVNTRIQVEHTVTEE 301 SP +SE+ R+ + +AA Y NAGT EFLV+D GEF+F+E+NTRIQVEH +TE Sbjct: 242 SPGISEETRQAMTQAAVSLCEHVGYRNAGTCEFLVDDETGEFFFIEMNTRIQVEHPITEL 301 Query: 302 VTGLDVVKWQLRVAAGEELDFSQDDVEIEGHSMEFRINAEAPEKEFAPATGTLSTYDPPG 361 +TG+D+V QLR+AAGE L Q D+ GH++EFRI AE PE++F P G++ + PG Sbjct: 302 ITGIDLVAEQLRIAAGEPLGLWQSDITKRGHAIEFRICAEDPERDFMPGPGSVGRVELPG 361 Query: 362 GIGIRMDDAVRQGDEIGGDYDSMIAKLIVTGSDREEVLVRAERALNEFDIEGLRTVIPFH 421 G +R D + ++ YDS++AKLIV G DR L RA RAL+EF +EG+ T Sbjct: 362 GPWVRTDTWLTPQSKVSPFYDSLVAKLIVWGDDRPTALRRAGRALSEFIVEGVPTTTALL 421 Query: 422 RLMLTDEAFREGSHTTKYLDEVLDPERIEAA 452 R + T+ F EG T L+ L ER +AA Sbjct: 422 REITTEPWFEEGQFNTGTLEAWL-AERSQAA 451 Lambda K H 0.312 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 682 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 601 Length of database: 457 Length adjustment: 35 Effective length of query: 566 Effective length of database: 422 Effective search space: 238852 Effective search space used: 238852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory