Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_089303126.1 CHB84_RS19595 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_900188115.1:WP_089303126.1 Length = 272 Score = 127 bits (320), Expect = 2e-34 Identities = 84/254 (33%), Positives = 130/254 (51%), Gaps = 4/254 (1%) Query: 7 LVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSEKAFAAGAD 66 LVE RG +VT+NRP+A NAL+ +++ + A D D +I + ++TG+ +F AGAD Sbjct: 17 LVEQRGHTLIVTMNRPEARNALSGEMLEIMVDAWNTVDNDPSIRSCILTGAGGSFCAGAD 76 Query: 67 IGMMSTYTY-MDVYKGDYITRNWETV---RSIRKPIIAAVAGFALGGGCELAMMCDIIFA 122 + MS + G + E + R + KP+IAAV G A+ GG E+ DI A Sbjct: 77 LKSMSKNNPGTAMSSGGWDPSRIEGLLKGRRLTKPLIAAVEGPAIAGGTEILQGTDIRVA 136 Query: 123 ADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRVIP 182 +A+FG E + + P G RLPR + A D+ LT R + A EA+ GL+ V+ Sbjct: 137 GRSARFGVSEARWSLFPMGGSAVRLPRQIPYTVAADILLTGRHVTADEAKDIGLIGHVVD 196 Query: 183 AASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQKE 242 + +D+A+ A + AV + ++ E + +L ++F + D KE Sbjct: 197 DGTALDKALEMAELVNANGPLAVQAILRTMRDTEGMHEEEAFGIDAKLGLNVFTSADAKE 256 Query: 243 GMAAFVEKRKPVFK 256 G AF EKR P F+ Sbjct: 257 GPRAFAEKRTPQFR 270 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 272 Length adjustment: 25 Effective length of query: 233 Effective length of database: 247 Effective search space: 57551 Effective search space used: 57551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory