Align 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 (characterized)
to candidate WP_089303318.1 CHB84_RS20610 alpha-ketoacid dehydrogenase subunit beta
Query= SwissProt::Q5SLR3 (324 letters) >NCBI__GCF_900188115.1:WP_089303318.1 Length = 322 Score = 261 bits (668), Expect = 1e-74 Identities = 150/323 (46%), Positives = 199/323 (61%), Gaps = 3/323 (0%) Query: 4 MTMVQALNRALDEEMAKDPRVVVLGEDVGK-RGGVFLVTEGLLQKYGPDRVMDTPLSEAA 62 MTM A+N ALD + D +V++LGED+ GGV VT GL KYG RV TP+SE A Sbjct: 1 MTMAVAMNSALDLALDGDEKVILLGEDIADPAGGVLKVTRGLSSKYGTGRVRATPISETA 60 Query: 63 IVGAALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSGGG 122 I+G A+G A G RPVAEI F D++ DQ+ + AKLRY SGG T P+ +R + G Sbjct: 61 IIGTAIGAALAGYRPVAEIMFMDFMGVCLDQITNHAAKLRYMSGGHSTIPITIRT-TVGE 119 Query: 123 VRGGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEPKRLYRSVKE 182 R G HSQS EA F+HT G+KVV ST +AKGLL + + D+DP +F+E RL S K+ Sbjct: 120 QRFGAQHSQSLEAWFMHTPGIKVVMPSTAIEAKGLLASCVADDDPCLFIENVRLAFSQKQ 179 Query: 183 EVPEEDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPW 242 EVP DY +P+G+A ++R G DL++I YG + L A LA G+ EV+DLRTL+P Sbjct: 180 EVPVGDYRIPLGEADVKRPGADLSVITYGPAVHTALATAETLADEGIDLEVVDLRTLIPL 239 Query: 243 DYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYPYA 302 D +VM+SVAKT + +++ DA +E+AA I E+L L AP R+ P PYA Sbjct: 240 DMASVMDSVAKTRKAIVLHDATTFCGPGAEIAARITEELFGKLDAPVKRLGAGYHPAPYA 299 Query: 303 QDKL-YLPTVTRILNAAKRALDY 324 L YLPT + + A+ L Y Sbjct: 300 PSGLSYLPTSDELADTARELLGY 322 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 322 Length adjustment: 28 Effective length of query: 296 Effective length of database: 294 Effective search space: 87024 Effective search space used: 87024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory