Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_089303391.1 CHB84_RS21025 hypothetical protein
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_900188115.1:WP_089303391.1 Length = 318 Score = 129 bits (324), Expect = 7e-35 Identities = 82/246 (33%), Positives = 132/246 (53%), Gaps = 16/246 (6%) Query: 17 ITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSR-KAFAAGADIKEMAERDL 75 +T+ RP+ NA++ + L L +A A +++ R +V+TG+ KAF AGAD+ + +L Sbjct: 72 VTIDRPQRRNAMSFETLQSLRDGVARARAESDVRLLVITGAGDKAFCAGADLGGVRGEEL 131 Query: 76 VGILEDPRVAHWQR---------IAAFSKPLIAAVNGFCLGGGCELAMHADILIAGEDAR 126 D AH R + + P +A V+G+ L GG LAM DI+IA +DA Sbjct: 132 -----DAEAAHEDRGRLAELFRTMWSSGIPTVAKVHGYALAGGFGLAMACDIVIASDDAV 186 Query: 127 FGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVSEVTLPELTI 186 FG PE+ +G+ P T LLR++ +A++++++G+ + A AQR G V+EV P Sbjct: 187 FGTPEVGVGLWPYM-ITVPLLRSMPPKVALELMMTGRRVGAVEAQRLGFVNEVVAPGELD 245 Query: 187 ERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGTADRAEGIRAF 246 + I ++P A+RL + + +A D+ L + +V TAD +EG+ AF Sbjct: 246 AAVDRVGEQIVAQSPTAIRLGRTSFYRALDSSTEQALALLQSMLSVATTTADASEGVAAF 305 Query: 247 QEKRRP 252 EKR P Sbjct: 306 AEKRTP 311 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 318 Length adjustment: 26 Effective length of query: 231 Effective length of database: 292 Effective search space: 67452 Effective search space used: 67452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory