Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_089322249.1 CHB58_RS01095 LPS export ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_900188395.1:WP_089322249.1 Length = 245 Score = 155 bits (391), Expect = 9e-43 Identities = 84/235 (35%), Positives = 143/235 (60%), Gaps = 5/235 (2%) Query: 1 MLQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRY 60 +L N+ YG + +V+++V++GE+V L+G NGAGK+T + G + G + + Sbjct: 8 VLSAVNLKKVYGSRTVVENVSLKVKEGEVVGLLGPNGAGKTTTFYCIIGLVKPEDGKV-F 66 Query: 61 MGEELVGQDSSHIM-RKSIAVVPEGRRVFARLTVEENL--AMGGFFTDKGDYQEQMDKVL 117 +GEE + D ++I RK ++ +P+ +F +LTVEENL M K + ++ + +L Sbjct: 67 IGEEEITNDPTYIRARKGLSYLPQEASIFRKLTVEENLIAVMEMHNYPKREIEKTTETLL 126 Query: 118 HLFPRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIE 177 F +K R T+SGGE++ L I RAL KPK LLLDEP G+ PI + I ++I+ Sbjct: 127 EEFG-IKHLRKNRADTLSGGERRRLEIARALTIKPKFLLLDEPFAGVDPIAVADIQNLIK 185 Query: 178 QLRKDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLG 232 +L+K + + + + N + L+I DRAY++ +G+V+ +GT E +++ KV++ YLG Sbjct: 186 ELKKRDIGILITDHNVRETLRIIDRAYIISHGKVLAEGTPEEIISSEKVKKVYLG 240 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 245 Length adjustment: 23 Effective length of query: 210 Effective length of database: 222 Effective search space: 46620 Effective search space used: 46620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory