Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_089323494.1 CHB58_RS07525 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_900188395.1:WP_089323494.1 Length = 266 Score = 114 bits (284), Expect = 3e-30 Identities = 80/262 (30%), Positives = 130/262 (49%), Gaps = 23/262 (8%) Query: 3 EKSNKVLLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMN 62 E + +L+VK L +GG+ AV V EV ++V+LIG NGAGKTT +TG Sbjct: 2 EAQKEPILEVKNLTKKFGGLVAVDNVTLEVYPEQIVALIGPNGAGKTTFFNCVTGIYKPT 61 Query: 63 DGNIEYLGKS-----IKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAG 117 G+I K I G + + GL + +F MT EN+ +G + R + G Sbjct: 62 SGDIFLKTKEGKKVRINGLKPNQITELGLARTFQNIRLFPNMTALENVMIGRHCR-TRTG 120 Query: 118 ILA--------------DIEKMFTIFPR--LRERKDQLAGTMSGGEQQMLAMGRALMSQP 161 IL IEK + + L + ++LA + G Q+ L + RAL ++P Sbjct: 121 ILGAIFRPPKTKEEEEETIEKSYQLLKTVGLEKYVNELAKNLPYGAQRRLEIARALATEP 180 Query: 162 KVLLLDEPSMGLSPIMVDKIFEVVRDVY-ALGVTIVLVEQNASRALAIADRGYVMESGLI 220 +LLLDEP+ G++P ++ +++ + + I+L+E + + I++ YVME G + Sbjct: 181 TILLLDEPAAGMNPKETAELMDLIYHIRDNEKIAILLIEHDMKLVMNISEMVYVMEYGRL 240 Query: 221 TMTGPGQQLLNDPKVRAAYLGE 242 G +++ +P V AYLGE Sbjct: 241 LAKGTPEEIRRNPDVIKAYLGE 262 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 266 Length adjustment: 24 Effective length of query: 218 Effective length of database: 242 Effective search space: 52756 Effective search space used: 52756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory