Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate WP_090438607.1 BLS63_RS01125 ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_09905 (231 letters) >NCBI__GCF_900100495.1:WP_090438607.1 Length = 231 Score = 376 bits (965), Expect = e-109 Identities = 188/229 (82%), Positives = 210/229 (91%) Query: 1 MMIDLHGFGPALAAGALMTVKLALSALCLGLVLGLLGALAKTSPYKPLQWLGGTYSTLVR 60 M +DL+GFGPALAAG LMT+KLALSAL LGLVLGLLGALAKTSPYKPLQWLGG+YSTLVR Sbjct: 1 MTLDLYGFGPALAAGTLMTIKLALSALSLGLVLGLLGALAKTSPYKPLQWLGGSYSTLVR 60 Query: 61 GIPELLWVLLIYFGTVNLMRALGEYLGMPDLALNAFAAGVIALGLCFGAYATEVFRGAIL 120 G+PELLWVLLIYFG+V+L+R+L + LG+ L L+AFAAG IALGLCFGAYATEVFRGAIL Sbjct: 61 GVPELLWVLLIYFGSVSLLRSLADLLGVASLELSAFAAGTIALGLCFGAYATEVFRGAIL 120 Query: 121 AIPKGHREAGVALGLSKWRIFTRLIMPQMWRIALPGLGNLFMILMKDTALVSVIGLEEIM 180 AIPKGHREAG ALGLSK RIF RLI+PQMWRIALPGLGNLFMILMKDTAL+SVIGLEEIM Sbjct: 121 AIPKGHREAGQALGLSKLRIFRRLILPQMWRIALPGLGNLFMILMKDTALISVIGLEEIM 180 Query: 181 RHAQIGVTVSKQPFTFYMVAALMYLGLTVLAMLGMHLLERRAARGFARS 229 R +QI VT SK+PFTF++VAA +YLGLTVLAMLG+H LE+RA+ GF RS Sbjct: 181 RRSQIAVTSSKEPFTFFLVAAFIYLGLTVLAMLGLHFLEKRASLGFVRS 229 Lambda K H 0.329 0.143 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 231 Length of database: 231 Length adjustment: 23 Effective length of query: 208 Effective length of database: 208 Effective search space: 43264 Effective search space used: 43264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory