Align 3-oxoadipate enol-lactonase (EC 3.1.1.24); 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) (characterized)
to candidate WP_090441193.1 BLS63_RS05840 alpha/beta hydrolase
Query= BRENDA::Q0SH24 (400 letters) >NCBI__GCF_900100495.1:WP_090441193.1 Length = 266 Score = 115 bits (287), Expect = 2e-30 Identities = 79/230 (34%), Positives = 116/230 (50%), Gaps = 8/230 (3%) Query: 19 APVVVLLGSLGSNRSMWDPQIAALSYECRVVAVDQRGHGESPAPDGPYSVRDLSEDVLAL 78 APV+++ G LGS+ W+ QIA L+ R++AVD RGHG S P YS+ +EDV AL Sbjct: 20 APVLLVHG-LGSSTRDWEYQIAELAAHYRLIAVDLRGHGRSDKPRERYSIAGFAEDVAAL 78 Query: 79 LDSLGVDAAHFVGLSMGGAIAQWLGAHAPRRVLSLSLLCTA--AKFGEPQAWIERAAASR 136 ++ LG+DA H VG+SMGG + LG P + SL ++ + K P+ ++E A R Sbjct: 79 IEHLGLDAVHLVGISMGGMVGFQLGVDRPELLKSLCIVNSGPEVKAKSPRDYLE--IAKR 136 Query: 137 TDGPESLADAVVARWFSEGLAKR--DPEFVRHYREMIASTSPEGYAACCDALADWDFTAD 194 L+ V+A+ L + E R E Y A DA+ W Sbjct: 137 WSLSRLLSLQVIAKGLGRLLFPKPEQAELRRKIEERWPQNDKRAYLASLDAIIGWGVRER 196 Query: 195 LSRISAPTLVIAGEEDPSTPPSVMQILADGITEARFEVLSPAAHVANLEQ 244 L+RI+ PTLVI+ + D TP + + + AR V+ + H L+Q Sbjct: 197 LARITCPTLVISADRD-YTPVAQKEAYVRELPNARLLVIEDSRHATPLDQ 245 Lambda K H 0.318 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 266 Length adjustment: 28 Effective length of query: 372 Effective length of database: 238 Effective search space: 88536 Effective search space used: 88536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory