Align Glutamate/aspartate import permease protein GltJ (characterized)
to candidate WP_090442758.1 BLS63_RS08605 amino acid ABC transporter permease
Query= SwissProt::P0AER3 (246 letters) >NCBI__GCF_900100495.1:WP_090442758.1 Length = 394 Score = 85.5 bits (210), Expect = 1e-21 Identities = 46/125 (36%), Positives = 75/125 (60%), Gaps = 1/125 (0%) Query: 116 LCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPNAYRVIVPPMTSE 175 L L ++TAA + E VR+ I ++ GQ AA ++GL + R V++P A RVI+PP+TS+ Sbjct: 267 LALTIYTAAFIAENVRSGILAVSHGQTEAARSLGLPAGKTLRLVIIPQALRVIIPPLTSQ 326 Query: 176 MMNLVKNSAIASTIGLVDMAAQ-AGKLLDYSAHAWESFTAITLAYVLINAFIMLVMTLVE 234 +NL KNS++A+ IG DM + AG +L+ + A E Y+ I+ I ++M Sbjct: 327 YLNLAKNSSLAAGIGYPDMVSLFAGTVLNQTGQAIEVIAITMSVYLAISISISMLMNWYN 386 Query: 235 RKVRL 239 +++ L Sbjct: 387 KRIAL 391 Score = 53.1 bits (126), Expect = 8e-12 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 5/87 (5%) Query: 28 GFQVTIALSICAWIIAFLVGSFFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTWYLV 87 G T+ +S+ + A ++G G+ R PN + L T+Y+E FRN+P ++Q F WY Sbjct: 88 GLLNTLLVSVIGIVGATILGFILGVARLSPNWLIGKLATVYIETFRNIPPLLQIFFWYFA 147 Query: 88 IPELLPEKIGMWFKAELDPNIQFFLSS 114 + LP + L+ FFL+S Sbjct: 148 VMLSLPGP-----RQSLEIGQAFFLNS 169 Lambda K H 0.328 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 246 Length of database: 394 Length adjustment: 27 Effective length of query: 219 Effective length of database: 367 Effective search space: 80373 Effective search space used: 80373 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory