Align PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_090442761.1 BLS63_RS08610 amino acid ABC transporter permease
Query= TCDB::Q88NY3 (248 letters) >NCBI__GCF_900100495.1:WP_090442761.1 Length = 365 Score = 107 bits (268), Expect = 3e-28 Identities = 72/213 (33%), Positives = 113/213 (53%), Gaps = 13/213 (6%) Query: 28 GLGWTIAIAITAWIIALLLGSLLGVMRTVPNRLVSGIATAYVELFRNVPLLVQLFIWYFL 87 GL T+ IA AL LG +L + R + I ++E +R VPL+ LF+ + Sbjct: 157 GLMLTLVIASVGIAGALPLGIVLALGRRSDMPAIRVICVTFIEFWRGVPLITVLFMSSVM 216 Query: 88 VPDLLPEGLQEWFKQDLNPTTSALISVVICLGLFTAARVCEQVRTGIQALPKGQEAAARA 147 +P LPEGL + ALI V+ LF +A + E VR G+QA+PKGQ AA A Sbjct: 217 LPLFLPEGLS------FDKLMRALIGVI----LFQSAYIAEVVRGGLQAIPKGQYEAAAA 266 Query: 148 MGFSLPQIYNNVLLPQAYRIIIPPLTSEFLNVFKNSSVASLIGLMELLAQTKQTAEFSAN 207 MG ++ V+LPQA +++IP + + F+ +FK++S+ +IGL ++L KQ A Sbjct: 267 MGLGYWRMMGLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDVLNSIKQATTDPAW 326 Query: 208 L---FEAFTLATLIYFTLNMGLMLLMRMVEKKV 237 L E + A L+++ G+ +E+K+ Sbjct: 327 LGMATEGYVFAALLFWIFCFGMSRYSMHLERKL 359 Lambda K H 0.325 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 365 Length adjustment: 27 Effective length of query: 221 Effective length of database: 338 Effective search space: 74698 Effective search space used: 74698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory