Align Ornithine carbamoyltransferase, catabolic; OTCase; EC 2.1.3.3 (characterized)
to candidate WP_090443601.1 BLS63_RS10650 ornithine carbamoyltransferase
Query= SwissProt::P08308 (336 letters) >NCBI__GCF_900100495.1:WP_090443601.1 Length = 336 Score = 575 bits (1482), Expect = e-169 Identities = 272/336 (80%), Positives = 309/336 (91%) Query: 1 MAFNMHNRNLLSLMHHSTRELRYLLDLSRDLKRAKYTGTEQQHLKRKNIALIFEKTSTRT 60 MAFNMHNR+LLSL+HHS +EL YLLDL+RDLKRAKY+GTEQQHL RKNIALIFEKTSTRT Sbjct: 1 MAFNMHNRSLLSLLHHSPQELHYLLDLARDLKRAKYSGTEQQHLLRKNIALIFEKTSTRT 60 Query: 61 RCAFEVAAYDQGANVTYIDPNSSQIGHKESMKDTARVLGRMYDAIEYRGFKQEIVEELAK 120 RCAFEVAAYDQGA+VTYIDP+SSQIGHKES+KDTARVLGR+YDAIEYRG+ QE+VEELA+ Sbjct: 61 RCAFEVAAYDQGAHVTYIDPSSSQIGHKESLKDTARVLGRLYDAIEYRGYGQELVEELAR 120 Query: 121 FAGVPVFNGLTDEYHPTQMLADVLTMREHSDKPLHDISYAYLGDARNNMGNSLLLIGAKL 180 FAGVPVFNGLTDEYHPTQMLADV+TMREHSDKPLHDI YAYLGDARNNMGNSLLL+GAKL Sbjct: 121 FAGVPVFNGLTDEYHPTQMLADVMTMREHSDKPLHDIGYAYLGDARNNMGNSLLLVGAKL 180 Query: 181 GMDVRIAAPKALWPHDEFVAQCKKFAEESGAKLTLTEDPKEAVKGVDFVHTDVWVSMGEP 240 GM+VRIAAPKALWPH E V QC+ FA SGA+++L EDP+EAVKG+DF+HTDVWVSMGEP Sbjct: 181 GMEVRIAAPKALWPHAELVEQCRAFAAASGARISLGEDPQEAVKGIDFIHTDVWVSMGEP 240 Query: 241 VEAWGERIKELLPYQVNMEIMKATGNPRAKFMHCLPAFHNSETKVGKQIAEQYPNLANGI 300 W +RI +LLPYQVN ++++A+GNPR KFMHCLPA HNSET+VG IA +YP LA G+ Sbjct: 241 TATWDQRIAQLLPYQVNAQLLQASGNPRVKFMHCLPALHNSETRVGHDIAARYPQLAGGV 300 Query: 301 EVTEDVFESPYNIAFEQAENRMHTIKAILVSTLADI 336 EVT++VFESP NIAFEQAENRMHTIKA+LV+TL D+ Sbjct: 301 EVTDEVFESPANIAFEQAENRMHTIKAVLVATLGDL 336 Lambda K H 0.318 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 336 Length adjustment: 28 Effective length of query: 308 Effective length of database: 308 Effective search space: 94864 Effective search space used: 94864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_090443601.1 BLS63_RS10650 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00658.hmm # target sequence database: /tmp/gapView.20723.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-134 432.7 0.0 3.9e-134 432.6 0.0 1.0 1 lcl|NCBI__GCF_900100495.1:WP_090443601.1 BLS63_RS10650 ornithine carbamoy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900100495.1:WP_090443601.1 BLS63_RS10650 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 432.6 0.0 3.9e-134 3.9e-134 1 303 [. 8 333 .. 8 334 .. 0.99 Alignments for each domain: == domain 1 score: 432.6 bits; conditional E-value: 3.9e-134 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 r+llsll++s++el++ll+la++lk++k++g+e+++l +k++aliFek+stRtR++fevaay++Ga+v+ lcl|NCBI__GCF_900100495.1:WP_090443601.1 8 RSLLSLLHHSPQELHYLLDLARDLKRAKYSGTEQQHLLRKNIALIFEKTSTRTRCAFEVAAYDQGAHVT 76 78******************************************************************* PP TIGR00658 70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllt 138 y++++++q+g+kes+kDtarvl+r++dai +R+y +e veela++a+vPv+ngLtd+ hP+q+laD++t lcl|NCBI__GCF_900100495.1:WP_090443601.1 77 YIDPSSSQIGHKESLKDTARVLGRLYDAIEYRGYGQELVEELARFAGVPVFNGLTDEYHPTQMLADVMT 145 ********************************************************************* PP TIGR00658 139 ikeklg.klkevklvyvGDa.nnvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkle 205 ++e+ + l+++ ++y+GDa nn++nslll +aklG++v++a+P++l+p+ae+v++++++a+++g++++ lcl|NCBI__GCF_900100495.1:WP_090443601.1 146 MREHSDkPLHDIGYAYLGDArNNMGNSLLLVGAKLGMEVRIAAPKALWPHAELVEQCRAFAAASGARIS 214 ******99************************************************************* PP TIGR00658 206 ltedpkkavkdadviytDvwvsmGe.eekkeerlkllkpyqvneellela.kpevkflhCLPavr.... 268 l edp++avk+ d+i+tDvwvsmGe +++++r+++l pyqvn +ll+ + +p vkf+hCLPa + lcl|NCBI__GCF_900100495.1:WP_090443601.1 215 LGEDPQEAVKGIDFIHTDVWVSMGEpTATWDQRIAQLLPYQVNAQLLQASgNPRVKFMHCLPALHnset 283 *************************999*********************99****************** PP TIGR00658 269 ...............GeevtdevlegeasivfdeaenRlhaqkavlkall 303 G evtdev+e++a+i f++aenR+h++kavl+a+l lcl|NCBI__GCF_900100495.1:WP_090443601.1 284 rvghdiaarypqlagGVEVTDEVFESPANIAFEQAENRMHTIKAVLVATL 333 ***********************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (336 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.98 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory