Align Peroxisomal bifunctional enzyme; PBE; PBFE; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 (characterized)
to candidate WP_090443661.1 BLS63_RS10750 3-hydroxyacyl-CoA dehydrogenase
Query= SwissProt::Q08426 (723 letters) >NCBI__GCF_900100495.1:WP_090443661.1 Length = 413 Score = 300 bits (768), Expect = 9e-86 Identities = 170/418 (40%), Positives = 246/418 (58%), Gaps = 24/418 (5%) Query: 293 SARPVSSVGVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASKMQ 352 SA + V+G GTMGRGIV+S A A IPV+ +D++ L A ++ K+ Sbjct: 4 SALTLQQAAVIGAGTMGRGIVMSLANAGIPVLWLDNNPQMLEQALSVVAETNAHNV-KLG 62 Query: 353 QSGHPWSGPKPRLTSSVKE---LGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTN 409 + S + + V + L GVDLVIEAV+E + LK+Q+F L + KP A L +N Sbjct: 63 RISAEQSAARLACVTPVHDYAALKGVDLVIEAVYENLELKQQIFRSLDGILKPAAILASN 122 Query: 410 TSALDVDEIASSTDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKI 469 TSALD+D IA+ T RP V+G HFFSPAH+MKLLE++ ++P + + L ++I K+ Sbjct: 123 TSALDIDAIAAVTARPEQVLGLHFFSPAHIMKLLEIVRGAKTAPAVLEAALELGRRIGKV 182 Query: 470 GVVVGNCFGFVGNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDV 529 VV GNC GF+GNRML Y +A LL EG+ P++VD L+ FGF MGPFR+ D+ G+D+ Sbjct: 183 AVVAGNCHGFIGNRMLASYVREARMLLLEGALPQQVDAALQGFGFAMGPFRMYDVVGIDL 242 Query: 530 GWKSRK--GQGLTGPTLLPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLG 587 W++R+ G G PT+ + + LC LGRFGQK G G+Y+Y + Sbjct: 243 EWRARELAGFGQDEPTV---------------QVDNRLCGLGRFGQKVGMGYYRYAEG-S 286 Query: 588 RIHKPDPWLSKFLSRYRKTHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHID 647 R DP + + + + R ++ +EILERCL +L+NE +IL E IAA+ ID Sbjct: 287 REALHDPLVDALVLQVSEQLGFARREVAAEEILERCLLALVNEGAKILEEQIAANSHDID 346 Query: 648 VVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQG 705 +VYL+GYG+P KGGPM +A + GL + +L+ D +P+ ++KLA+ G Sbjct: 347 LVYLNGYGFPADKGGPMAWADSQGLAAIHARLKALQPLFGD--HWQPARLIEKLAASG 402 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 664 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 723 Length of database: 413 Length adjustment: 35 Effective length of query: 688 Effective length of database: 378 Effective search space: 260064 Effective search space used: 260064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory