Align protocatechuate 3,4-dioxygenase (subunit 2/2) (EC 1.13.11.3) (characterized)
to candidate WP_090443809.1 BLS63_RS11020 intradiol ring-cleavage dioxygenase
Query= BRENDA::A0A193DXA9 (206 letters) >NCBI__GCF_900100495.1:WP_090443809.1 Length = 217 Score = 63.2 bits (152), Expect = 4e-15 Identities = 53/155 (34%), Positives = 69/155 (44%), Gaps = 16/155 (10%) Query: 49 ARGERISVRGTVYDGAGMPLKDALIEIWQADTDG-YYNSPSETRGKADPNFIGWGRSPGD 107 A G + + G + D G PL+ AL+EIWQ D G Y +S R + D NF G+GR Sbjct: 65 ASGSVVQLHGQILDSRGQPLRGALVEIWQVDAHGIYLHSRGGDRARRDANFQGYGRFETA 124 Query: 108 MDTGEFVFETIKPGSVPFRDGRPMAPHITFWIVARGINIGLQTRMYFPEEQEANAADPVL 167 D G + F TI+P P R PHI F + G T+ Y E N D VL Sbjct: 125 SD-GRYRFRTIRPVPYPGR-----TPHIHFAVTLPG-QPRFATQCYIRGE-PLNQRDGVL 176 Query: 168 ARI-EQKSR------IATLVAKKEEGNVYRFDIRL 195 I + ++R L + V RFDI L Sbjct: 177 NAIRDPRARERLIVSFVPLAGSAVDEQVARFDIVL 211 Lambda K H 0.318 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 206 Length of database: 217 Length adjustment: 21 Effective length of query: 185 Effective length of database: 196 Effective search space: 36260 Effective search space used: 36260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory