Align histidine transport ATP-binding protein hisP (characterized)
to candidate WP_090443965.1 BLS63_RS11285 amino acid ABC transporter ATP-binding protein
Query= CharProtDB::CH_003210 (257 letters) >NCBI__GCF_900100495.1:WP_090443965.1 Length = 243 Score = 236 bits (602), Expect = 3e-67 Identities = 130/247 (52%), Positives = 169/247 (68%), Gaps = 12/247 (4%) Query: 6 LNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVN 65 LNV LHK YG++ VLKG+ L G V++IIG SGSGKST LR +N LE +G I V+ Sbjct: 4 LNVTALHKYYGDNHVLKGIDLAVEEGQVVAIIGRSGSGKSTLLRTLNGLESIDDGVIEVD 63 Query: 66 GQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSK 125 G+ ++ R AD LR LR ++ MVFQ FNL+ H++V EN+M AP V L++ Sbjct: 64 GEYLDAAR--------AD---LRSLRQKVGMVFQQFNLFPHLSVGENIMLAPQVVKKLAR 112 Query: 126 QEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDP 185 +EA + A + L +VG+ E+ YP LSGGQQQRV+IARALAM P VLL DE TSALDP Sbjct: 113 EEAAQLARQMLERVGLGEKFDA-YPERLSGGQQQRVAIARALAMSPRVLLCDEITSALDP 171 Query: 186 ELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNPQS 245 ELV EVL +++QLA EG T+++VTHEM FAR V ++F+HQGK+ E GAP LF PQ+ Sbjct: 172 ELVNEVLAVVKQLASEGMTLIMVTHEMRFAREVGDKLVFMHQGKVHEVGAPRTLFAEPQT 231 Query: 246 PRLQRFL 252 L+ F+ Sbjct: 232 AELRNFI 238 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 243 Length adjustment: 24 Effective length of query: 233 Effective length of database: 219 Effective search space: 51027 Effective search space used: 51027 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory