Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_090444457.1 BLS63_RS12140 short chain dehydrogenase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_900100495.1:WP_090444457.1 Length = 253 Score = 112 bits (280), Expect = 8e-30 Identities = 80/252 (31%), Positives = 120/252 (47%), Gaps = 12/252 (4%) Query: 10 YPGLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVS----ESALAVFRDKYPGTVATRAD 65 + G L++G AAGIG A A+ G +V V DV E + R R D Sbjct: 5 FSGQVALVTGAAAGIGRATALAFANEGLKVVVSDVDVAGGEGTAELIRAAGGEAAFVRCD 64 Query: 66 VSDAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFA 125 V+ +++A+ G LD NNAGI G + S+AE+ A I +N+ + Sbjct: 65 VTRETEVKALMDATLAAYGRLDYAFNNAGIEIEKGKLAEGSEAEFDAIIGVNVKGVWLCM 124 Query: 126 HHAVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNA 185 H +P+L G +++ ASVAG + YAA+K A++GL KS A E + IRVNA Sbjct: 125 KHQIPLLLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAVEYAKKKIRVNA 184 Query: 186 LLPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAA 245 + P ++ D + RA + +AE + R+ E++A L+LC A Sbjct: 185 VCPAVI-----DTDMFRRAYESDPKKAEFAAA---MHPVGRIGKVEEIATAVLYLCCDGA 236 Query: 246 RNVTGQAISVDG 257 TG A++VDG Sbjct: 237 AFTTGHALAVDG 248 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 253 Length adjustment: 24 Effective length of query: 238 Effective length of database: 229 Effective search space: 54502 Effective search space used: 54502 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory