Align Aconitate-delta-isomerase 1; Itaconic acid/2-hydroxyparaconate biosynthesis cluster protein ADI1; EC 5.-.-.- (characterized)
to candidate WP_090445413.1 BLS63_RS13860 4-oxalomesaconate tautomerase
Query= SwissProt::A0A0U2X0E4 (443 letters) >NCBI__GCF_900100495.1:WP_090445413.1 Length = 358 Score = 274 bits (701), Expect = 3e-78 Identities = 157/349 (44%), Positives = 212/349 (60%), Gaps = 15/349 (4%) Query: 2 LHPIDTTIYRAGTSRGLYFLASDLPAEPSERDAALISIMGSGHPLQIDGMGGGNSLTSKV 61 + I + R GTSRG FLA+ LP++P++RD L+ IMGSGH L+IDG+GGG+ TSKV Sbjct: 1 MQAIPCVLMRGGTSRGPVFLANHLPSDPAQRDELLLKIMGSGHELEIDGIGGGSPQTSKV 60 Query: 62 AIVSASTQRSEFDVDYLFCQVGITERFVDTAPNCGNLMSGVAAFAIERGLVQPHPSDTTC 121 AIVSAS+ + DVDYLF QV + +R VDTAPNCGN++ + FAIE GLV T Sbjct: 61 AIVSASSH-PQADVDYLFVQVMVAQRRVDTAPNCGNMLCAIGPFAIEHGLVNAAAPVTRV 119 Query: 122 LVRIFNLNSRQASELVIPVYNGRVHYD-DIDDMHMQRPSARVGLRFLDTVGSCTGKLLPT 180 +R N N+ SE++ P +GRV Y+ D + +A + L FLD G+ TG+LLPT Sbjct: 120 RIRNLNTNTLIDSEVLTP--HGRVRYEGDTQIDGVPGTAAPIKLTFLDAAGAKTGRLLPT 177 Query: 181 GNASDWIDGLKVSIIDSAVPVVFIRQHDVGITGSEAPATLNANTALLDRLERVRLEAGRR 240 G D DG++V+ ID A+P+V + +G +G E PA L+A+ LL RLE +RL+AGR Sbjct: 178 GQVRDRFDGVEVTCIDMAMPMVLMHAEALGKSGDETPAELDADAELLQRLESIRLQAGRA 237 Query: 241 MGLGDVSGSVVPKLSLIGPGTETTTFTARYFTPKACHNAHAVTGAICTAGAAYIDGSVVC 300 MGLGDV+ V+PK L+ P + + RYF P CH + A TGAI A A + GSV Sbjct: 238 MGLGDVTQMVIPKPVLLSPARQGGSLNTRYFMPHNCHRSLAATGAIGLASACALPGSVAF 297 Query: 301 EILSSRASACSASQRRISIEHPSGVLEVGL-----VPPENAAQSLVDVA 344 ++ R +A + +EHP G +EV L PPE SL+ A Sbjct: 298 DLAPVRGAAL------VRLEHPGGQIEVSLECAEDEPPEAMRASLIRTA 340 Lambda K H 0.318 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 358 Length adjustment: 31 Effective length of query: 412 Effective length of database: 327 Effective search space: 134724 Effective search space used: 134724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory